SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603526|ref|NP_246600.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603526|ref|NP_246600.1|
Domain Number 1 Region: 174-308
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.92e-47
Family ATP-dependent riboflavin kinase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 16-175
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.91e-36
Family Adenylyltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603526|ref|NP_246600.1|
Sequence length 311
Comment bifunctional riboflavin kinase/FMN adenylyltransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRLIRGIHNLPPNLSGCALTIGNFDGVHLGHQAILRHLRQKADALNLPVVVMLFEPQPRE
YFTGDAIPARLMRLRDKLHYLAQAKVDYVLCIRFNENFASQTAEEFIEDWLVKKLNVRFL
SIGDDFRFGAKRQGDFALLQKSGEAFGFFVEDNHSFCCDELRISSTAIREALAEDDLAYA
EKMLGKPYRILGRVAHGNKLGRTIGFPTANIPLHRQVNPVKGVYAVKVRLKNQEIYHGVA
NIGKRPTINGVVQLLEVHIFDFHSTIYGQCLEVEFCHKIRNEFKFPSFEALKEQIAQDVE
TAKHFFRTQQI
Download sequence
Identical sequences A0A290LL03 Q9CKF8
272843.PM1661 gi|15603526|ref|NP_246600.1| WP_010907278.1.19996 WP_010907278.1.41351 WP_010907278.1.41667 WP_010907278.1.58111 WP_010907278.1.66990 WP_010907278.1.88402 WP_010907278.1.92478 WP_010907278.1.93940 WP_010907278.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]