SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603534|ref|NP_246608.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603534|ref|NP_246608.1|
Domain Number 1 Region: 7-382
Classification Level Classification E-value
Superfamily Radical SAM enzymes 8.63e-106
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603534|ref|NP_246608.1|
Sequence length 384
Comment coproporphyrinogen III oxidase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNINRLPPLSLYIHIPWCVQKCPYCDFNSHAQKGHIPEQDYIAHLLQDLHQDRQRFQDSI
QDRSLHSIFIGGGTPSLFSAEGIHTLLSGVAQCLPFQPDIEITLEANPGTAEAERFKGYV
QAGVTRISMGIQSFNDDKLVRLGRIHNAQEAKSAVGFAKLSGLKSFNLDLMHGLPNQTLE
EALSDLQQAIALEPPHLSWYQLTIEPNTMFAYRPPVLPDDDALWDIFEQGHQLLTEAGYV
QYETSAYAKPAFQCRHNLNYWRFGDYLAIGCGAHGKITQPNGEIKRYSKTKHPKGYMRGD
YLYEEKTVATEDLAFEFFMNRFRLLEAVPKTDFTRLTGLCEESIQPQIQWALAKKYLVET
EVAWQVTEQGKLFLNELLAEFLPK
Download sequence
Identical sequences A0A126QGZ5 A0A2K2YLH4 Q9CKF2
gi|15603534|ref|NP_246608.1| 272843.PM1669 gi|386835545|ref|YP_006240864.1| WP_005724539.1.11014 WP_005724539.1.12311 WP_005724539.1.15732 WP_005724539.1.19996 WP_005724539.1.21657 WP_005724539.1.24757 WP_005724539.1.26777 WP_005724539.1.27592 WP_005724539.1.27664 WP_005724539.1.36022 WP_005724539.1.40210 WP_005724539.1.40787 WP_005724539.1.41657 WP_005724539.1.42469 WP_005724539.1.42512 WP_005724539.1.45422 WP_005724539.1.4808 WP_005724539.1.51342 WP_005724539.1.53852 WP_005724539.1.55074 WP_005724539.1.6219 WP_005724539.1.62389 WP_005724539.1.66990 WP_005724539.1.70689 WP_005724539.1.81885 WP_005724539.1.8281 WP_005724539.1.89773 WP_005724539.1.90578 WP_005724539.1.94432 WP_005724539.1.95718 WP_005724539.1.9746 WP_005724539.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]