SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603543|ref|NP_246617.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603543|ref|NP_246617.1|
Domain Number 1 Region: 25-329
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.01e-42
Family MoCo biosynthesis proteins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603543|ref|NP_246617.1|
Sequence length 374
Comment hypothetical protein PM1678 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MMNSFSRIEVVMQTPFQLMAKPTGSLCNLDCKYCFYLEKPHLQQRAMSDDMLEAYVKKYL
QLAPQKEVTFLWQGGEPTLAGIAFYQKAVEFQQKYANGKTIYNALQTNGVLLDKQWCQFL
QQNQFLVGLSIDGPEHLHDVYRVTKSQKGTFHQVMHALENLIAFNVSFNTLTVVHKQNVL
HGKAVYQFLKQIGSTYMQFIPLMGEWEQQAGAKEYGQFMIEIFDEWYAHDIGKIGVQFIE
QWLMAFLGMQPSLCIFRKTCGDQMIVEQNGDIFSCDHYVYPHYKIGNLIETPLKQIVYSA
QQQKFGADKQKVSHKCQQCQFYFACHGGCPKHRTVQGFGEAHNILCESYYSALSHMSPYL
KKLAIFLTKKQRLL
Download sequence
Identical sequences Q9CKE4
272843.PM1678 gi|15603543|ref|NP_246617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]