SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603544|ref|NP_246618.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603544|ref|NP_246618.1|
Domain Number 1 Region: 92-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000000855
Family Phosphate binding protein-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603544|ref|NP_246618.1|
Sequence length 319
Comment hypothetical protein PM1679 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKTWKSAIKASLIGLLGLVSINSMAQTNWPTAPVTIITPWAVGGLADQINRAMSEYGKEQ
YGQPLLADNILGSGGAVALTEYTKEKPNTHKLILGGEGSFAIAPLTMKVAYKFEDFVPVI
NIYSSTFVLVTNPRTKVDSIPSLKEYIAKGKKIKIATNGTNSSEALQSAALFNEMGAKYQ
IIPYDGANEALTAVISGEVDFATTHASLAKEFVKAGNAKAVVAFDEKKLVDDVYNLDSVV
DHGYDTWMINTCAVFIRAGTDQAIIDKNYQALKNILENPKLQQTAKNIGIRLDIKDGAAV
KAYIDSTMDKAAKYSKLVK
Download sequence
Identical sequences A0A1D7R4C0 Q9CKE3 V4N8D0
WP_005724546.1.10027 WP_005724546.1.10721 WP_005724546.1.11014 WP_005724546.1.12311 WP_005724546.1.1307 WP_005724546.1.14908 WP_005724546.1.15732 WP_005724546.1.17217 WP_005724546.1.17980 WP_005724546.1.18123 WP_005724546.1.19996 WP_005724546.1.20287 WP_005724546.1.21657 WP_005724546.1.22153 WP_005724546.1.2313 WP_005724546.1.23830 WP_005724546.1.24757 WP_005724546.1.26616 WP_005724546.1.26777 WP_005724546.1.27416 WP_005724546.1.27592 WP_005724546.1.29697 WP_005724546.1.30617 WP_005724546.1.34253 WP_005724546.1.35978 WP_005724546.1.36022 WP_005724546.1.39152 WP_005724546.1.3957 WP_005724546.1.40210 WP_005724546.1.40787 WP_005724546.1.41297 WP_005724546.1.41351 WP_005724546.1.41462 WP_005724546.1.41657 WP_005724546.1.41667 WP_005724546.1.4211 WP_005724546.1.42469 WP_005724546.1.42512 WP_005724546.1.42943 WP_005724546.1.44741 WP_005724546.1.45422 WP_005724546.1.47685 WP_005724546.1.4808 WP_005724546.1.50853 WP_005724546.1.51342 WP_005724546.1.52066 WP_005724546.1.53852 WP_005724546.1.55074 WP_005724546.1.57420 WP_005724546.1.57956 WP_005724546.1.58111 WP_005724546.1.58450 WP_005724546.1.58628 WP_005724546.1.58910 WP_005724546.1.59455 WP_005724546.1.60664 WP_005724546.1.61098 WP_005724546.1.61860 WP_005724546.1.62016 WP_005724546.1.6219 WP_005724546.1.62389 WP_005724546.1.65482 WP_005724546.1.65878 WP_005724546.1.66934 WP_005724546.1.66990 WP_005724546.1.70689 WP_005724546.1.73917 WP_005724546.1.74955 WP_005724546.1.75804 WP_005724546.1.79593 WP_005724546.1.80223 WP_005724546.1.80589 WP_005724546.1.80911 WP_005724546.1.81885 WP_005724546.1.8281 WP_005724546.1.86541 WP_005724546.1.87897 WP_005724546.1.88402 WP_005724546.1.89773 WP_005724546.1.90081 WP_005724546.1.90179 WP_005724546.1.90578 WP_005724546.1.91495 WP_005724546.1.92478 WP_005724546.1.93940 WP_005724546.1.94432 WP_005724546.1.94435 WP_005724546.1.95718 WP_005724546.1.9746 WP_005724546.1.9947 gi|386835555|ref|YP_006240874.1| gi|378775670|ref|YP_005177913.1| 272843.PM1679 gi|383311761|ref|YP_005364571.1| gi|15603544|ref|NP_246618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]