SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603560|ref|NP_246634.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603560|ref|NP_246634.1|
Domain Number 1 Region: 196-323
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 1.57e-42
Family Cell-division protein ZipA, C-terminal domain 0.0000509
Further Details:      
 
Weak hits

Sequence:  gi|15603560|ref|NP_246634.1|
Domain Number - Region: 119-193
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000353
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603560|ref|NP_246634.1|
Sequence length 323
Comment cell division protein ZipA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDLNTILIILGIIALIILVVHGLWANRREKSQYFKSANTFTRDSRLREPPAHIQSASEEK
KDANTSTPTAEVSPAQRTFAFEAEKQFAHEQQAVEQAIENIKITLPKEEQPYQAKIEPDT
PPTSPALTTIAEVENYANQEEGIDTHSEQLRQQLADLAQQSPSVTLAALQEEQALMESQA
QQQASEDVRQDTDATFIMMYVVAPENYQFQGARLAKILDELGFLFGEHNIYHRHSDLSVN
SPVLFSVANIEQPGTFDYNMHDFSTVGIALFMQLPSEGNDLMNLRMMIRAAKSIAEDLGG
FVLTDQQAIFDDQAEKAYLDKVR
Download sequence
Identical sequences A0A290LN14 Q9CKC8
272843.PM1695 WP_010907293.1.12311 WP_010907293.1.15732 WP_010907293.1.19996 WP_010907293.1.26777 WP_010907293.1.40210 WP_010907293.1.41351 WP_010907293.1.41667 WP_010907293.1.45422 WP_010907293.1.4808 WP_010907293.1.53852 WP_010907293.1.58111 WP_010907293.1.6219 WP_010907293.1.62389 WP_010907293.1.66990 WP_010907293.1.81885 WP_010907293.1.8281 WP_010907293.1.88402 WP_010907293.1.89773 WP_010907293.1.92478 WP_010907293.1.93940 WP_010907293.1.9746 WP_010907293.1.9947 gi|15603560|ref|NP_246634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]