SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603574|ref|NP_246648.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15603574|ref|NP_246648.1|
Domain Number - Region: 235-298
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 0.00445
Family Thiamin phosphate synthase 0.015
Further Details:      
 
Domain Number - Region: 153-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00736
Family Phosphate binding protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603574|ref|NP_246648.1|
Sequence length 327
Comment hypothetical protein PM1709 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKFKKLLLASLCLGVSASVFAADYDLKFGMVAGPSSNEYKAVEFFAKEVKEKSNGKIDVA
IFPSSQLGDDRVMIKQLKDGALDFTLGESARFQIYFPEAEVFALPYMIPNFETSKKALLD
TKFGQGLLKKIDKELNVQVLSVAYNGTRQTTSNRAINSIEDMKGLKLRVPNAATNLAYAK
YVGAAPTPMAFSEVYLALQTNSVDGQENPLPTIQAQKFYEVQKYLALTNHILNDQLYLIS
NDTLADLPEDLQKVVKDAAAKAAEYHTKLFVDGENSLVEFFKSQGVTVTQPDLKPFKAAL
TPYYDEYLKKNGEVGKMAIEEISNLAK
Download sequence
Identical sequences A0A1D2P099 J6CJS3 Q9CKB5 V4MSF0
gi|15603574|ref|NP_246648.1| gi|386835587|ref|YP_006240906.1| WP_005724599.1.11014 WP_005724599.1.11214 WP_005724599.1.11947 WP_005724599.1.12156 WP_005724599.1.12311 WP_005724599.1.14908 WP_005724599.1.15732 WP_005724599.1.17980 WP_005724599.1.19996 WP_005724599.1.21657 WP_005724599.1.23830 WP_005724599.1.24757 WP_005724599.1.26777 WP_005724599.1.27416 WP_005724599.1.27592 WP_005724599.1.28084 WP_005724599.1.35562 WP_005724599.1.36022 WP_005724599.1.3807 WP_005724599.1.38246 WP_005724599.1.3839 WP_005724599.1.3957 WP_005724599.1.40210 WP_005724599.1.40787 WP_005724599.1.41351 WP_005724599.1.41657 WP_005724599.1.41667 WP_005724599.1.42469 WP_005724599.1.42512 WP_005724599.1.43687 WP_005724599.1.45422 WP_005724599.1.4808 WP_005724599.1.49053 WP_005724599.1.51342 WP_005724599.1.52585 WP_005724599.1.52859 WP_005724599.1.53852 WP_005724599.1.55401 WP_005724599.1.57956 WP_005724599.1.58111 WP_005724599.1.58257 WP_005724599.1.60478 WP_005724599.1.61098 WP_005724599.1.6219 WP_005724599.1.62389 WP_005724599.1.6332 WP_005724599.1.63549 WP_005724599.1.66990 WP_005724599.1.70689 WP_005724599.1.72215 WP_005724599.1.74955 WP_005724599.1.75804 WP_005724599.1.78987 WP_005724599.1.79347 WP_005724599.1.79593 WP_005724599.1.81885 WP_005724599.1.8281 WP_005724599.1.83579 WP_005724599.1.88402 WP_005724599.1.89773 WP_005724599.1.90578 WP_005724599.1.92478 WP_005724599.1.93940 WP_005724599.1.94432 WP_005724599.1.95718 WP_005724599.1.9746 WP_005724599.1.9947 272843.PM1709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]