SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603607|ref|NP_246681.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603607|ref|NP_246681.1|
Domain Number 1 Region: 6-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 5.1e-83
Family Ribosomal protein L1 0.000000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603607|ref|NP_246681.1|
Sequence length 229
Comment 50S ribosomal protein L1 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKLTKKMKSIKAAVDSTKAYEINEAIAVLKQFATAKFVESVDVAVNLGIDPRKSDQNVR
GATVLPHGTGRSVRVAVFTQGANAEAAKEAGADLVGMEDLAELVKKGEMNFDVVIASPDA
MRVVGQLGQILGPRGLMPNPKVGTVTPNVADAVKNAKSGQVRYRNDKNGIIHTTIGKVNF
SEEQLKENLQALLAALAKAKPTTSKGVFIKKVSLSTTMGAGVAIDQASL
Download sequence
Identical sequences A0A1E3XLB1 A0A2K2YLD4 Q9CK86 V4MSN4
WP_005718821.1.10027 WP_005718821.1.10721 WP_005718821.1.11014 WP_005718821.1.12311 WP_005718821.1.1307 WP_005718821.1.14908 WP_005718821.1.15732 WP_005718821.1.17217 WP_005718821.1.17980 WP_005718821.1.18123 WP_005718821.1.19996 WP_005718821.1.20287 WP_005718821.1.21657 WP_005718821.1.22153 WP_005718821.1.2313 WP_005718821.1.23830 WP_005718821.1.24757 WP_005718821.1.26616 WP_005718821.1.26777 WP_005718821.1.27416 WP_005718821.1.27664 WP_005718821.1.29697 WP_005718821.1.30617 WP_005718821.1.34253 WP_005718821.1.35978 WP_005718821.1.36022 WP_005718821.1.39152 WP_005718821.1.3957 WP_005718821.1.40210 WP_005718821.1.40787 WP_005718821.1.41297 WP_005718821.1.41351 WP_005718821.1.41462 WP_005718821.1.41667 WP_005718821.1.42469 WP_005718821.1.42943 WP_005718821.1.44741 WP_005718821.1.45422 WP_005718821.1.47685 WP_005718821.1.4808 WP_005718821.1.50853 WP_005718821.1.51342 WP_005718821.1.52066 WP_005718821.1.53852 WP_005718821.1.55074 WP_005718821.1.57420 WP_005718821.1.57956 WP_005718821.1.58111 WP_005718821.1.58450 WP_005718821.1.58628 WP_005718821.1.58910 WP_005718821.1.59455 WP_005718821.1.60664 WP_005718821.1.61098 WP_005718821.1.61860 WP_005718821.1.62016 WP_005718821.1.6219 WP_005718821.1.62389 WP_005718821.1.65482 WP_005718821.1.65878 WP_005718821.1.66934 WP_005718821.1.66990 WP_005718821.1.70689 WP_005718821.1.73917 WP_005718821.1.74955 WP_005718821.1.75804 WP_005718821.1.79593 WP_005718821.1.80223 WP_005718821.1.80589 WP_005718821.1.80911 WP_005718821.1.81885 WP_005718821.1.8281 WP_005718821.1.86541 WP_005718821.1.87897 WP_005718821.1.88402 WP_005718821.1.89773 WP_005718821.1.90081 WP_005718821.1.90179 WP_005718821.1.90578 WP_005718821.1.91495 WP_005718821.1.92478 WP_005718821.1.93940 WP_005718821.1.94435 WP_005718821.1.95718 WP_005718821.1.9746 WP_005718821.1.9947 gi|378775607|ref|YP_005177850.1| gi|383311616|ref|YP_005364426.1| gi|15603607|ref|NP_246681.1| 272843.PM1742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]