SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603624|ref|NP_246698.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603624|ref|NP_246698.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.7e-45
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 126-263
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.62e-25
Family Glucose 6-phosphate dehydrogenase-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603624|ref|NP_246698.1|
Sequence length 367
Comment hypothetical protein PM1759 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MMKYGVVGVGYFGADLARFMNENENAKVTMVYDPENGETIAKELQCIAATSLKQLVSSPE
VDCVIVATPNYLHKEPVIEAAKHGKHVFCEKPIALNYQDCDEMVRTCEENGVIFMAGHVM
NFFNGVHHAKELIKQGVIGKVLYCHSARNGWEDEQPSISWKKIRAKSGGHLYHHIHELDC
IQFIMGGMPKTVTMTAGNVAHQSEKFGDEDDMLFLNLEFEGGRFAVLEWGSAFRWGEHYV
LIQGEKGAIKLDMYHCKGTLRVDGKDSHFLIHETQEEDDDRTRIYTSTEMDGAIQYGKPG
KRTPMWLSSIMKKEMKYLNDILHGMKPTEEFEKLLTGEAARAAIATADACTKSRYENRKV
EVAEITG
Download sequence
Identical sequences A0A290M0H0 Q9CK74
WP_005724717.1.12311 WP_005724717.1.15732 WP_005724717.1.19996 WP_005724717.1.40210 WP_005724717.1.41351 WP_005724717.1.41667 WP_005724717.1.45422 WP_005724717.1.4808 WP_005724717.1.53852 WP_005724717.1.58111 WP_005724717.1.6219 WP_005724717.1.62389 WP_005724717.1.66990 WP_005724717.1.70689 WP_005724717.1.81885 WP_005724717.1.8281 WP_005724717.1.88402 WP_005724717.1.89773 WP_005724717.1.92478 WP_005724717.1.93940 WP_005724717.1.9746 WP_005724717.1.9947 gi|15603624|ref|NP_246698.1| 272843.PM1759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]