SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603627|ref|NP_246701.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603627|ref|NP_246701.1|
Domain Number 1 Region: 21-446
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.22e-83
Family Phosphate binding protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603627|ref|NP_246701.1|
Sequence length 451
Comment hypothetical protein PM1762 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKLKKLFSVLLPIIAGASILTGCNEENKTTQANTAMPKEGQELAGNITFWHSFTQGPRLE
VIQQAAKEFEQKNPKVKIKIETFSWNDFYTKWTTGLSSGNVPDLSTALPNQVVEMINFGA
LQPLGDLIDSIGRDKFAEAAISEGTVQGQNYSIPLYSHAQVMWIRKDLLEKHQLPVPKTW
NELYETAKKLTQDGVYGLSVPMGSNDFIATRFLNLYVRSGGGSLLTKDLKVDLTNPLAQE
GIKYWVKMYKDTSPKDSVNYNVLQQATLYYQGKTAFDFNSGFQIGGVKANSPQLLEFIDA
YPVPKINENDPTPALETANIPMVIWKNSKHPDVSKAFMKTLYEKERYISFLKAVPVGMLP
AIKGISDDPAYKDEPIIKQFEHAEKVITEAVQLGTAIGYEHGPSVQAGILTNQHIIEKMF
QDIVINGTDPMVAAQKAEKELNSLLEAVITK
Download sequence
Identical sequences Q9CK72
gi|15603627|ref|NP_246701.1| WP_010907318.1.12311 WP_010907318.1.15732 WP_010907318.1.19996 WP_010907318.1.40210 WP_010907318.1.45422 WP_010907318.1.4808 WP_010907318.1.53852 WP_010907318.1.6219 WP_010907318.1.62389 WP_010907318.1.66990 WP_010907318.1.81885 WP_010907318.1.8281 WP_010907318.1.89773 WP_010907318.1.9746 WP_010907318.1.9947 272843.PM1762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]