SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603634|ref|NP_246708.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603634|ref|NP_246708.1|
Domain Number 1 Region: 104-402
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 5e-50
Family Lambda integrase-like, catalytic core 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603634|ref|NP_246708.1|
Sequence length 417
Comment hypothetical protein PM1769 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MARLVKKLTDSEIKNAKATSKPLYDGEGLFLEVSSKGAKLWRFRYAQPYTKKRTTISLGT
YPDLSLSQARAKRDEFNALLANNIDPQTYRKQQEQAQADRLSRTFDKMAKAWFEDRKIKA
NFSERTAKDTWALFERHLLPHFANYPITEITPLIAINALKPLEKEGKLETVKKTIGNLNN
VMRFALHRGLIPHNPLAEIGKEFDKPVSKGMNTITPEELSEFLHGFYRARDENRFNPFSF
YAVMLVVLTGGRPSEIAKAKWADINYKEKTWTYRVQKGNKNLPEGREHVVTLSHQAIGIF
NKMQHLHTALGIESEFVFASLTAKSGHLSIETMRKAIIKGIGENRLTTHGIRHLFSTSLN
EKDYKADWIERALSHKQNKDKNQIRRTYDKSLYLSQRAVMLQEWADYVESQAPEPIV
Download sequence
Identical sequences Q9CK65
gi|15603634|ref|NP_246708.1| WP_010907323.1.66990 WP_010907323.1.9947 272843.PM1769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]