SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603637|ref|NP_246711.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15603637|ref|NP_246711.1|
Domain Number - Region: 13-62
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00275
Family DNA-binding N-terminal domain of transcription activators 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603637|ref|NP_246711.1|
Sequence length 65
Comment hypothetical protein PM1772 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSTTQTNQTPIKKYYSINELTALGIGSRTKIDRLAKQGLLKKIKIGGSVRFSADEVNAFI
QSTNA
Download sequence
Identical sequences A0A2J9QM92 C9PSH3 Q9CK62 V4NA41
gi|378775170|ref|YP_005177413.1| WP_005764228.1.10027 WP_005764228.1.1307 WP_005764228.1.17217 WP_005764228.1.18123 WP_005764228.1.20287 WP_005764228.1.21657 WP_005764228.1.22153 WP_005764228.1.2313 WP_005764228.1.23830 WP_005764228.1.26616 WP_005764228.1.27416 WP_005764228.1.29697 WP_005764228.1.30617 WP_005764228.1.34253 WP_005764228.1.35978 WP_005764228.1.39152 WP_005764228.1.41462 WP_005764228.1.4211 WP_005764228.1.44741 WP_005764228.1.47685 WP_005764228.1.50853 WP_005764228.1.51342 WP_005764228.1.52066 WP_005764228.1.57420 WP_005764228.1.58450 WP_005764228.1.58628 WP_005764228.1.58968 WP_005764228.1.59455 WP_005764228.1.60664 WP_005764228.1.62016 WP_005764228.1.65482 WP_005764228.1.65878 WP_005764228.1.66934 WP_005764228.1.66990 WP_005764228.1.73917 WP_005764228.1.74955 WP_005764228.1.75804 WP_005764228.1.80589 WP_005764228.1.80911 WP_005764228.1.86541 WP_005764228.1.90179 WP_005764228.1.91495 WP_005764228.1.9947 272843.PM1772 gi|15603637|ref|NP_246711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]