SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603654|ref|NP_246728.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603654|ref|NP_246728.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.08e-30
Family Sigma2 domain of RNA polymerase sigma factors 0.00000472
Further Details:      
 
Domain Number 2 Region: 122-182
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.8e-17
Family Sigma4 domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603654|ref|NP_246728.1|
Sequence length 191
Comment RNA polymerase sigma factor RpoE [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAEQLTDQALVERVQQGDKKAFNLLVSRYQNKVAGLLTRYVSQNDIPDVVQESFIKAYRS
IDSFRGDSAFYTWLYRIAVNTAKNYLTAQGRRPPNEDILAEEAESYEMGSNLRDVDTPEN
EMLSSELKKIVFDTINGLQEDLRTAITLRELEGLSYEEIAEIMDCPVGTVRSRIFRAREI
IESKVQPMLQR
Download sequence
Identical sequences A0A1D7R5Q4 A0A2K2YXV6 Q9CK45 V4MTX8
WP_005755383.1.10027 WP_005755383.1.10721 WP_005755383.1.11014 WP_005755383.1.12311 WP_005755383.1.14908 WP_005755383.1.15732 WP_005755383.1.17980 WP_005755383.1.18123 WP_005755383.1.19996 WP_005755383.1.20287 WP_005755383.1.21657 WP_005755383.1.22153 WP_005755383.1.23830 WP_005755383.1.24757 WP_005755383.1.26777 WP_005755383.1.27416 WP_005755383.1.27592 WP_005755383.1.27664 WP_005755383.1.29697 WP_005755383.1.34253 WP_005755383.1.35978 WP_005755383.1.36022 WP_005755383.1.39152 WP_005755383.1.3957 WP_005755383.1.40210 WP_005755383.1.40787 WP_005755383.1.41297 WP_005755383.1.41351 WP_005755383.1.41462 WP_005755383.1.41657 WP_005755383.1.41667 WP_005755383.1.4211 WP_005755383.1.42469 WP_005755383.1.42512 WP_005755383.1.42943 WP_005755383.1.44741 WP_005755383.1.45422 WP_005755383.1.47685 WP_005755383.1.4808 WP_005755383.1.50853 WP_005755383.1.51342 WP_005755383.1.52066 WP_005755383.1.53852 WP_005755383.1.55074 WP_005755383.1.57420 WP_005755383.1.57956 WP_005755383.1.58111 WP_005755383.1.58450 WP_005755383.1.58628 WP_005755383.1.58910 WP_005755383.1.59455 WP_005755383.1.60664 WP_005755383.1.61098 WP_005755383.1.61860 WP_005755383.1.62016 WP_005755383.1.6219 WP_005755383.1.62389 WP_005755383.1.65482 WP_005755383.1.65878 WP_005755383.1.66934 WP_005755383.1.66990 WP_005755383.1.74955 WP_005755383.1.75804 WP_005755383.1.79593 WP_005755383.1.80223 WP_005755383.1.80589 WP_005755383.1.81885 WP_005755383.1.8281 WP_005755383.1.86541 WP_005755383.1.87897 WP_005755383.1.88402 WP_005755383.1.89773 WP_005755383.1.90081 WP_005755383.1.90179 WP_005755383.1.90578 WP_005755383.1.91495 WP_005755383.1.92478 WP_005755383.1.93940 WP_005755383.1.94432 WP_005755383.1.94435 WP_005755383.1.95718 WP_005755383.1.9746 WP_005755383.1.9947 272843.PM1789 gi|386835165|ref|YP_006240482.1| gi|15603654|ref|NP_246728.1| gi|378775151|ref|YP_005177394.1| gi|383311174|ref|YP_005363984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]