SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603675|ref|NP_246749.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603675|ref|NP_246749.1|
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily CheY-like 1.71e-33
Family CheY-related 0.0000408
Further Details:      
 
Domain Number 2 Region: 135-206
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 3.37e-23
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603675|ref|NP_246749.1|
Sequence length 209
Comment NarP protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSEKMKVLIIDDHPLMRRGIKQLMELAPNFEVVADAGNGSEGISLALQTQPDLIILDLNM
KGLSGLDTLKALRAEGIDARILILTVSDLKSDIFTLIDAGADGYLLKDTEPDALLSQIQR
IAQGEVILSDSIKDALIERQMNADPIYSLTDREMDVLRLIATGLSNKQIAGQLFISEETV
KVHIRNLLRKLNVHSRVAATVLYFEHKGR
Download sequence
Identical sequences A0A1E3XKF7 J5KFE4 Q9CK25
WP_005724807.1.10027 WP_005724807.1.10721 WP_005724807.1.11014 WP_005724807.1.11214 WP_005724807.1.11947 WP_005724807.1.12156 WP_005724807.1.12311 WP_005724807.1.1307 WP_005724807.1.14908 WP_005724807.1.15732 WP_005724807.1.17217 WP_005724807.1.17980 WP_005724807.1.18123 WP_005724807.1.19996 WP_005724807.1.20287 WP_005724807.1.22153 WP_005724807.1.2313 WP_005724807.1.24757 WP_005724807.1.26616 WP_005724807.1.26777 WP_005724807.1.27592 WP_005724807.1.28084 WP_005724807.1.29697 WP_005724807.1.30617 WP_005724807.1.34253 WP_005724807.1.35562 WP_005724807.1.35978 WP_005724807.1.36022 WP_005724807.1.3807 WP_005724807.1.38246 WP_005724807.1.3839 WP_005724807.1.39152 WP_005724807.1.3957 WP_005724807.1.40210 WP_005724807.1.40787 WP_005724807.1.41297 WP_005724807.1.41351 WP_005724807.1.41462 WP_005724807.1.41657 WP_005724807.1.41667 WP_005724807.1.42469 WP_005724807.1.42943 WP_005724807.1.43687 WP_005724807.1.44741 WP_005724807.1.45422 WP_005724807.1.47685 WP_005724807.1.4808 WP_005724807.1.49053 WP_005724807.1.50853 WP_005724807.1.52066 WP_005724807.1.52585 WP_005724807.1.52859 WP_005724807.1.53852 WP_005724807.1.55074 WP_005724807.1.55401 WP_005724807.1.57420 WP_005724807.1.57956 WP_005724807.1.58111 WP_005724807.1.58257 WP_005724807.1.58450 WP_005724807.1.58628 WP_005724807.1.58910 WP_005724807.1.59455 WP_005724807.1.60478 WP_005724807.1.60664 WP_005724807.1.61098 WP_005724807.1.61860 WP_005724807.1.62016 WP_005724807.1.6219 WP_005724807.1.62389 WP_005724807.1.6332 WP_005724807.1.63549 WP_005724807.1.65482 WP_005724807.1.65878 WP_005724807.1.66934 WP_005724807.1.66990 WP_005724807.1.70689 WP_005724807.1.72215 WP_005724807.1.73917 WP_005724807.1.74955 WP_005724807.1.75804 WP_005724807.1.78987 WP_005724807.1.79347 WP_005724807.1.79593 WP_005724807.1.80223 WP_005724807.1.80589 WP_005724807.1.80911 WP_005724807.1.81885 WP_005724807.1.8281 WP_005724807.1.83579 WP_005724807.1.86541 WP_005724807.1.87897 WP_005724807.1.88402 WP_005724807.1.89773 WP_005724807.1.90081 WP_005724807.1.90179 WP_005724807.1.90578 WP_005724807.1.91495 WP_005724807.1.92478 WP_005724807.1.93940 WP_005724807.1.94432 WP_005724807.1.94435 WP_005724807.1.95718 WP_005724807.1.9746 WP_005724807.1.9947 272843.PM1810 gi|378775130|ref|YP_005177373.1| gi|15603675|ref|NP_246749.1| gi|386835143|ref|YP_006240460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]