SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603690|ref|NP_246764.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603690|ref|NP_246764.1|
Domain Number 1 Region: 97-300
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-30
Family Sulfatase-modifying factor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603690|ref|NP_246764.1|
Sequence length 511
Comment hypothetical protein PM1825 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MCKYVYTLLSLCVVSSATQAAWEEKFYNPQPLENDVILPLPCEGNMVFRVVKTNTQQPLE
DTLVTLGGNREQDGYAEYATPNYIAGGFADKDKERFFLMAKYEVTEAQYQAVMTEKCNTP
TLKGLLPMTNITWFDAMTFTQKYNEWLLKQAKGALPTEDGVAGFVRLPTNVEWEFASRGG
VAVTPSEFRENTFPMQDGLVNYAWFNNAKSANGRLQVIGRLKPNPLGLFDTLGNASEMMF
DSFKMNKLSRYHGQEGGVIVRGGSYLKSEADVNNVLRLEMPFYDQQGAKKAKDVGFRVVI
AAPLLTSSERIKSVEKAWEALGKDHQQPEKGENSKIVDKLEELANNTVDEKLKQELNNTK
EQLRAANLERDEQRDSAVRSALQLGAFLCANVSDLQGEVEQNKKILEAMTALYPNSEKET
NAKNRLAESENARDFVLKYYADTIVASSTTYNKQTIETQVSRTNAIVSSSGKANLTQYVN
LYWRHLEQYYQDNKISRQAWLEKCTQVKQGN
Download sequence
Identical sequences A0A290M169 Q9CK12
WP_010907362.1.12311 WP_010907362.1.15732 WP_010907362.1.19996 WP_010907362.1.26777 WP_010907362.1.40210 WP_010907362.1.41297 WP_010907362.1.41351 WP_010907362.1.41667 WP_010907362.1.45422 WP_010907362.1.4808 WP_010907362.1.53852 WP_010907362.1.57956 WP_010907362.1.58111 WP_010907362.1.6219 WP_010907362.1.62389 WP_010907362.1.66990 WP_010907362.1.79593 WP_010907362.1.81885 WP_010907362.1.8281 WP_010907362.1.88402 WP_010907362.1.89773 WP_010907362.1.92478 WP_010907362.1.93940 WP_010907362.1.9746 WP_010907362.1.9947 272843.PM1825 gi|15603690|ref|NP_246764.1| gi|383311137|ref|YP_005363947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]