SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603695|ref|NP_246769.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603695|ref|NP_246769.1|
Domain Number 1 Region: 267-565
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.49e-88
Family DNA repair protein MutS, domain III 0.00000000255
Further Details:      
 
Domain Number 2 Region: 566-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-59
Family ABC transporter ATPase domain-like 0.0000000143
Further Details:      
 
Domain Number 3 Region: 114-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.19e-41
Family DNA repair protein MutS, domain II 0.00000142
Further Details:      
 
Domain Number 4 Region: 5-113
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.27e-41
Family DNA repair protein MutS, domain I 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603695|ref|NP_246769.1|
Sequence length 860
Comment DNA mismatch repair protein MutS [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDNLDLHTPMMRQYLALKAENPDILLFYRMGDFYELFYDDAKKAAALLDISLTKRGQSAG
QPIPMAGVPYHAVEGYLAKLVQLGESVAICEQVGDPATSKGPVERQVVRIVTPGTVSDES
LLPERQDNLIATVYQEKDRFGLAVLDITSGRFQISEPEDRASLQAELQRISPVELLYCED
FVDMALLEPFKGLRRRPIWEFELGTAIQLLNRQFHTKDLRGFGVEKAILGLCAAGCLLQY
AKDTQRTALPHIQSLTLLQHSEHIQLDAATRRNLELTQNLAGGSENTLASVLDKCVTPMG
SRLLKRWMHQPIRQHEKLMVRQNRITALLQQDLVAAIQPYLQQIGDMERILARVALRSAR
PRDLTRLRTALEQIPYLRDILAQQTSSDLTALLQPIGEFSAQLDLLQRAIIDNPPMLIRD
GGVIAEGYNAELDEWRSLSDGATRYLEELEQRERESTGIDTLKIGFNAVHGYYIQISQGQ
AHKAPMHYVRRQTLKNAERYIIPELKTYEDKVLKAKGAALALEKQLYEQLFDELLPHLGA
LQLASLTLAELDVLTNLAERAETLNYVAPQFSDDIGVHIQQGRHPVVEQVLNAPFIANPV
ELHPQRHLLIITGPNMGGKSTYMRQTALITLMAYMGSFVPAESAVIGPIDRIFTRIGASD
DLASGRSTFMVEMTEMANILHQATANSLVLIDEIGRGTSTYDGLSLAWACAEWLAKKLRS
LTLFATHYFELTVLPEQLAGSANVHLDAIEHNDTIAFMHAVQEGAASKSYGLAVAALAGV
PQSVIKLAKQKLAQLEKLSQQNADQRIQDLRQLNQTQGELALMEEDDSKTAVWEMLEKLD
PDELSPKQALAYLYQLKKLV
Download sequence
Identical sequences A0A290LVQ6 P57972
gi|15603695|ref|NP_246769.1| WP_005724843.1.12311 WP_005724843.1.15732 WP_005724843.1.19996 WP_005724843.1.27592 WP_005724843.1.40210 WP_005724843.1.41351 WP_005724843.1.41667 WP_005724843.1.42512 WP_005724843.1.45422 WP_005724843.1.4808 WP_005724843.1.53852 WP_005724843.1.58111 WP_005724843.1.6219 WP_005724843.1.62389 WP_005724843.1.66990 WP_005724843.1.70689 WP_005724843.1.81885 WP_005724843.1.8281 WP_005724843.1.88402 WP_005724843.1.89773 WP_005724843.1.92478 WP_005724843.1.93940 WP_005724843.1.94432 WP_005724843.1.9746 WP_005724843.1.9947 272843.PM1830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]