SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603698|ref|NP_246772.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603698|ref|NP_246772.1|
Domain Number 1 Region: 8-445
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.06e-141
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.00000000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603698|ref|NP_246772.1|
Sequence length 459
Comment coproporphyrinogen III oxidase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGEIMSEIVWDLALIQKYNQSGPRYTSYPTALEFNENYTNQDFIQATKRYPNRPLSLYVH
IPFCHKLCYFCACNKTITRHQHKADIYLDFLEREIEHRAPLFKDRIATQVHWGGGTPTYL
TEQQSARLMAMLRKHFTIAPDAEISIEMDPREIELNMLDHLRRIGFNRMSMGVQDFNKDV
QKAINRVQDEDFIEALLKRARELGFQSTNLDLIYGLPLQNVDSFMFTLQKVIALNPDRLS
VFNYAHLPSRFAGQAKIKNEQLPAPETKLTILQKMIETLGDAGYKFIGMDHFAKPDDELA
IAQQQGVLHRNFQGYTTQEECDLLGLGVSAISLLGDTYAQNQKELKHYYTAIDNTGIALH
KGFAMSEEDCLRRDVIKQLICNFKLDYQPIEQQYGIQFTSHFAEDLKLLAPLSEDGLLEI
GEKAIQVSAKGRLLIRNICLCFDTYSREQAKRQQFSRII
Download sequence
Identical sequences Q9CK05
272843.PM1833 gi|15603698|ref|NP_246772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]