SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15603710|ref|NP_246784.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603710|ref|NP_246784.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 3.01e-29
Family DR1885-like metal-binding protein 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603710|ref|NP_246784.1|
Sequence length 136
Comment hypothetical protein PM1845 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKSLTQLLFILTALLPTSLFAHIHVEQAQMFSAKAGEPSAIFMNIHNTGNEDVSLALVQS
DIRADIVLHGTQHGKMIEVTGINLPAHQMTALKRGGLHIMVFNVEQDLNVGDSFPLRLLF
DNGEIMHIEAKIIQYQ
Download sequence
Identical sequences Q9CJZ3
WP_010907377.1.12311 WP_010907377.1.15732 WP_010907377.1.19996 WP_010907377.1.40210 WP_010907377.1.45422 WP_010907377.1.4808 WP_010907377.1.53852 WP_010907377.1.6219 WP_010907377.1.62389 WP_010907377.1.66990 WP_010907377.1.81885 WP_010907377.1.8281 WP_010907377.1.89773 WP_010907377.1.9746 272843.PM1845 gi|15603710|ref|NP_246784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]