SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603712|ref|NP_246786.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603712|ref|NP_246786.1|
Domain Number 1 Region: 68-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.28e-40
Family L-arabinose binding protein-like 0.00094
Further Details:      
 
Domain Number 2 Region: 9-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000964
Family GalR/LacI-like bacterial regulator 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603712|ref|NP_246786.1|
Sequence length 339
Comment protein ScrR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSITNKKRITLSDIAKCCGLSTTTVSMILNNRGEEFKIKAETCQRVKAIAEQQGYRANVY
AKSLKMQRSNVIGFVIPDLTNYGFACTAKILEKQCRENGLQLIIACSDDNPQQEKLAIER
LLDRQIDFLITAPTHQDPSYYQKIGQHTPILQLDRYVPDLALNYVISNDSEHITALICRL
CDQYQLTEFMYFGGQRTLSPSESRLAGFLQGLKQANLNLKKEWILHRTYQPESGYQMLAE
TEAKLGRLPQAIFTASYTLLEGVLRYLTEQKKMDLLLNRQLHLATFDDHDILNALPFHIH
SIKQNHPQLAHQIFQHIMRYFAGKKSPNQKIDCDVIYRD
Download sequence
Identical sequences Q9CJZ1
gi|15603712|ref|NP_246786.1| 272843.PM1847 WP_010907378.1.12311 WP_010907378.1.15732 WP_010907378.1.19996 WP_010907378.1.40210 WP_010907378.1.45422 WP_010907378.1.4808 WP_010907378.1.53852 WP_010907378.1.6219 WP_010907378.1.62389 WP_010907378.1.66990 WP_010907378.1.81885 WP_010907378.1.8281 WP_010907378.1.89773 WP_010907378.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]