SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603713|ref|NP_246787.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603713|ref|NP_246787.1|
Domain Number 1 Region: 48-356
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.24e-76
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 386-477
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603713|ref|NP_246787.1|
Sequence length 499
Comment protein ScrB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MPFSLSKVRSFFCHFWTSPMYIFNQGKYKSLHAQQVGELAQIRQHVLRDTQFRPTYHLAP
ETGLLNDPNGLVFDGEKYHIFYQWFPYAAIHGMKHWKHFMTYDFHHFQVADPLIPDELFE
SHGCYSGGALLWQDQIVAFYTGNTRNAENQRIPHQNIAIFKKDGTLLKKRCLLNQAPTGY
TEHVRDPKPFITEEGKIRFILGAQREDLSGTALIYEMTDLDATPQLIGEFKLPDFDNQQV
FMWECPDLLKLQEQDLFLWSPQGKAQKTYCFQNHYHATYALGQYANLHFSAQHIEELDYG
FDFYAPQSIQGSEGIYYAWVGLPDLTYPTDEYQWHSMLSLPRQFSIQQGILYQRPIPQVY
AQCLPAHKYWVEGKQQIPHLDRSYVAFDAENQPFTLRFFTNQRGQQLILRYQNGILTLDR
TYTTQTALMQQFGEQRHCILPQLNHVEIFFDRSVVEIFLNQGEKVMTSRFFIADRENALD
SSRPLCVSVAELKPIILTP
Download sequence
Identical sequences Q9CJZ0
272843.PM1848 gi|15603713|ref|NP_246787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]