SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603735|ref|NP_246809.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603735|ref|NP_246809.1|
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.35e-40
Family Putative Holliday junction resolvase RuvX 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603735|ref|NP_246809.1|
Sequence length 140
Comment Holliday junction resolvase-like protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGMTVLAFDFGTKSIGCAVGQSITGTAQALPAFKAQDGIPNWDAIGKCLAEWQPDRVVVG
LPLNMDGTEQDLTVRARKFAHRLHGRFGVAVELQDERLTTTEARAEIFGRGGYKALNKSK
VDGISACLILESWFENQQVK
Download sequence
Identical sequences A0A1D7R5X4 Q9CJX0 V4NAH4
gi|378775070|ref|YP_005177313.1| 272843.PM1870 gi|15603735|ref|NP_246809.1| WP_005755497.1.10027 WP_005755497.1.10721 WP_005755497.1.12311 WP_005755497.1.1307 WP_005755497.1.14908 WP_005755497.1.15732 WP_005755497.1.17217 WP_005755497.1.17980 WP_005755497.1.18123 WP_005755497.1.19996 WP_005755497.1.20287 WP_005755497.1.21657 WP_005755497.1.22153 WP_005755497.1.2313 WP_005755497.1.23830 WP_005755497.1.26616 WP_005755497.1.26777 WP_005755497.1.27416 WP_005755497.1.29697 WP_005755497.1.30617 WP_005755497.1.34253 WP_005755497.1.35978 WP_005755497.1.36022 WP_005755497.1.39152 WP_005755497.1.3957 WP_005755497.1.40210 WP_005755497.1.41351 WP_005755497.1.41462 WP_005755497.1.41667 WP_005755497.1.42943 WP_005755497.1.44741 WP_005755497.1.45422 WP_005755497.1.47685 WP_005755497.1.4808 WP_005755497.1.50853 WP_005755497.1.51342 WP_005755497.1.52066 WP_005755497.1.53852 WP_005755497.1.57420 WP_005755497.1.58111 WP_005755497.1.58450 WP_005755497.1.58628 WP_005755497.1.58910 WP_005755497.1.59455 WP_005755497.1.60664 WP_005755497.1.61098 WP_005755497.1.61860 WP_005755497.1.62016 WP_005755497.1.6219 WP_005755497.1.62389 WP_005755497.1.65482 WP_005755497.1.65878 WP_005755497.1.66934 WP_005755497.1.66990 WP_005755497.1.73917 WP_005755497.1.74955 WP_005755497.1.75804 WP_005755497.1.79593 WP_005755497.1.80223 WP_005755497.1.80589 WP_005755497.1.80911 WP_005755497.1.81885 WP_005755497.1.8281 WP_005755497.1.86541 WP_005755497.1.87897 WP_005755497.1.88402 WP_005755497.1.89773 WP_005755497.1.90081 WP_005755497.1.90179 WP_005755497.1.91495 WP_005755497.1.92478 WP_005755497.1.93940 WP_005755497.1.94435 WP_005755497.1.95718 WP_005755497.1.9746 WP_005755497.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]