SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603736|ref|NP_246810.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603736|ref|NP_246810.1|
Domain Number 1 Region: 143-429
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.11e-127
Family Enolase 0.000000000806
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-56
Family Enolase N-terminal domain-like 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603736|ref|NP_246810.1|
Sequence length 433
Comment phosphopyruvate hydratase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALELRDGDKARFL
GKGVLKAVAAVNNEIAQALVGKDATNQAEIDQIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLFAWIAELNGTPGQYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKTLK
EALRIGAEVFHNLAKVLKGKGLSTAVGDEGGFAPNLESNAAALACIKEAVEKAGYVLGKD
VTLAMDCASSEFYNKENGMYEMKGEGKSFTSQEFTHYLEELCKEYPIVSIEDGQDESDWE
GFAYQTKVLGDKVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRIAKYNQLIRIEEALGDK
APFLGLKAVKGQA
Download sequence
Identical sequences A0A1E3XHK7 P57975
gi|386835082|ref|YP_006240399.1| WP_005724946.1.11014 WP_005724946.1.11214 WP_005724946.1.11947 WP_005724946.1.12156 WP_005724946.1.12311 WP_005724946.1.14908 WP_005724946.1.15732 WP_005724946.1.17980 WP_005724946.1.19996 WP_005724946.1.21657 WP_005724946.1.24757 WP_005724946.1.26777 WP_005724946.1.27592 WP_005724946.1.28084 WP_005724946.1.35562 WP_005724946.1.36022 WP_005724946.1.3807 WP_005724946.1.38246 WP_005724946.1.3839 WP_005724946.1.3957 WP_005724946.1.40210 WP_005724946.1.40787 WP_005724946.1.41297 WP_005724946.1.41351 WP_005724946.1.41657 WP_005724946.1.41667 WP_005724946.1.4211 WP_005724946.1.42469 WP_005724946.1.42512 WP_005724946.1.43687 WP_005724946.1.45422 WP_005724946.1.4808 WP_005724946.1.49053 WP_005724946.1.51342 WP_005724946.1.52585 WP_005724946.1.52859 WP_005724946.1.53852 WP_005724946.1.55401 WP_005724946.1.57956 WP_005724946.1.58111 WP_005724946.1.58257 WP_005724946.1.60478 WP_005724946.1.61098 WP_005724946.1.6219 WP_005724946.1.62389 WP_005724946.1.6332 WP_005724946.1.63549 WP_005724946.1.66990 WP_005724946.1.70689 WP_005724946.1.72215 WP_005724946.1.78987 WP_005724946.1.79347 WP_005724946.1.79593 WP_005724946.1.81885 WP_005724946.1.8281 WP_005724946.1.83579 WP_005724946.1.88402 WP_005724946.1.89773 WP_005724946.1.90578 WP_005724946.1.92478 WP_005724946.1.93940 WP_005724946.1.94432 WP_005724946.1.95718 WP_005724946.1.9746 WP_005724946.1.9947 gi|383311092|ref|YP_005363902.1| gi|15603736|ref|NP_246810.1| 272843.PM1871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]