SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603741|ref|NP_246815.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603741|ref|NP_246815.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-46
Family Ribonuclease PH domain 1-like 0.00000215
Further Details:      
 
Domain Number 2 Region: 154-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-26
Family Ribonuclease PH domain 2-like 0.0000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603741|ref|NP_246815.1|
Sequence length 238
Comment ribonuclease PH [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRPNERANNQPRPIKITRHYTKHAEGSVLVEFGDTKVLCTATVEESVPRFLKGQNQGWVT
AEYGMLPRSTHSRMQREAAKGKQGGRTLEIQRLIARSLRAMVDLEALGERSITLDCDVIQ
ADGGTRTASITGACVALCDAIHGLVENGTLKVNPIKSLVAAISVGIVEGVPVCDLEYVED
SAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAKEGCQLIFDVQRQALAK
Download sequence
Identical sequences A0A1E3XHK8 Q9CJW5 V4Q1I0
gi|378775064|ref|YP_005177307.1| WP_005724954.1.10027 WP_005724954.1.10721 WP_005724954.1.11014 WP_005724954.1.12311 WP_005724954.1.1307 WP_005724954.1.14908 WP_005724954.1.15732 WP_005724954.1.17217 WP_005724954.1.17980 WP_005724954.1.18123 WP_005724954.1.19996 WP_005724954.1.20287 WP_005724954.1.21657 WP_005724954.1.22153 WP_005724954.1.2313 WP_005724954.1.23830 WP_005724954.1.24757 WP_005724954.1.26616 WP_005724954.1.26777 WP_005724954.1.27416 WP_005724954.1.27592 WP_005724954.1.29697 WP_005724954.1.30617 WP_005724954.1.34253 WP_005724954.1.35978 WP_005724954.1.36022 WP_005724954.1.39152 WP_005724954.1.3957 WP_005724954.1.40210 WP_005724954.1.40787 WP_005724954.1.41297 WP_005724954.1.41351 WP_005724954.1.41462 WP_005724954.1.41657 WP_005724954.1.41667 WP_005724954.1.42469 WP_005724954.1.42512 WP_005724954.1.42943 WP_005724954.1.44741 WP_005724954.1.45422 WP_005724954.1.47685 WP_005724954.1.4808 WP_005724954.1.50853 WP_005724954.1.51342 WP_005724954.1.52066 WP_005724954.1.53852 WP_005724954.1.55074 WP_005724954.1.57420 WP_005724954.1.57956 WP_005724954.1.58111 WP_005724954.1.58450 WP_005724954.1.58628 WP_005724954.1.58910 WP_005724954.1.59455 WP_005724954.1.60664 WP_005724954.1.61098 WP_005724954.1.61860 WP_005724954.1.62016 WP_005724954.1.6219 WP_005724954.1.62389 WP_005724954.1.65482 WP_005724954.1.65878 WP_005724954.1.66934 WP_005724954.1.66990 WP_005724954.1.70689 WP_005724954.1.73917 WP_005724954.1.74955 WP_005724954.1.75804 WP_005724954.1.79593 WP_005724954.1.80223 WP_005724954.1.80589 WP_005724954.1.80911 WP_005724954.1.81885 WP_005724954.1.8281 WP_005724954.1.86541 WP_005724954.1.87897 WP_005724954.1.88402 WP_005724954.1.89773 WP_005724954.1.90081 WP_005724954.1.90179 WP_005724954.1.90578 WP_005724954.1.91495 WP_005724954.1.92478 WP_005724954.1.93940 WP_005724954.1.94435 WP_005724954.1.95718 WP_005724954.1.9746 WP_005724954.1.9947 gi|386835077|ref|YP_006240394.1| gi|383311086|ref|YP_005363896.1| gi|15603741|ref|NP_246815.1| 272843.PM1876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]