SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603752|ref|NP_246826.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603752|ref|NP_246826.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily CheY-like 1.1e-40
Family CheY-related 0.0000959
Further Details:      
 
Domain Number 2 Region: 131-230
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.02e-22
Family PhoB-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603752|ref|NP_246826.1|
Sequence length 233
Comment protein CpxR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MPKILLVDDDVELIELLAELLTLEGFEIDMANNGLQALQKLDLSYDLVLLDIMMPVLNGV
ETLKKIRQEFSVPVIMLTARGDDIDRILGLELGADDYIPKPFNDRELVARIKAILRRTQP
AATLNTEVKENRSEFVFCDITLYPGRQQAFHHDKDLELTGTEFALLQKLVLNPGQILSRE
SLSIEILGKQLTPFDRAIDMHMSNLRKKLPPRTDGSPWFKTLRGRGYLLVSEK
Download sequence
Identical sequences A0A1D2NVT8 A0A2K2YXL4 Q9CJV4
gi|386835066|ref|YP_006240383.1| 272843.PM1887 gi|15603752|ref|NP_246826.1| WP_005724968.1.11014 WP_005724968.1.11214 WP_005724968.1.11947 WP_005724968.1.12156 WP_005724968.1.12311 WP_005724968.1.14908 WP_005724968.1.15732 WP_005724968.1.17980 WP_005724968.1.19996 WP_005724968.1.21657 WP_005724968.1.24757 WP_005724968.1.26777 WP_005724968.1.27416 WP_005724968.1.27592 WP_005724968.1.27664 WP_005724968.1.28084 WP_005724968.1.35562 WP_005724968.1.3807 WP_005724968.1.38246 WP_005724968.1.3839 WP_005724968.1.3957 WP_005724968.1.40210 WP_005724968.1.40787 WP_005724968.1.41351 WP_005724968.1.41657 WP_005724968.1.41667 WP_005724968.1.4211 WP_005724968.1.42469 WP_005724968.1.42512 WP_005724968.1.43687 WP_005724968.1.45422 WP_005724968.1.4808 WP_005724968.1.49053 WP_005724968.1.50853 WP_005724968.1.51342 WP_005724968.1.52585 WP_005724968.1.52859 WP_005724968.1.53852 WP_005724968.1.55074 WP_005724968.1.55401 WP_005724968.1.58111 WP_005724968.1.58257 WP_005724968.1.58628 WP_005724968.1.60478 WP_005724968.1.61098 WP_005724968.1.6219 WP_005724968.1.62389 WP_005724968.1.6332 WP_005724968.1.63549 WP_005724968.1.66990 WP_005724968.1.70689 WP_005724968.1.72215 WP_005724968.1.78987 WP_005724968.1.79347 WP_005724968.1.79593 WP_005724968.1.81885 WP_005724968.1.8281 WP_005724968.1.83579 WP_005724968.1.86541 WP_005724968.1.88402 WP_005724968.1.89773 WP_005724968.1.90578 WP_005724968.1.92478 WP_005724968.1.93940 WP_005724968.1.94432 WP_005724968.1.9746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]