SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603758|ref|NP_246832.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603758|ref|NP_246832.1|
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 1.25e-57
Family Dihydrofolate reductases 0.00000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603758|ref|NP_246832.1|
Sequence length 164
Comment hypothetical protein PM1893 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTFSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
LVLSRQPYLHEGVIWQNSLESAVDFVKDSPEILLIGGGELFKQYLHKADKLYLTEIQTEL
EGDTFFPEIVWQDWQIEYEAWHQADEKNPYDCRFLILSRNTKNE
Download sequence
Identical sequences Q9CJU8
272843.PM1893 WP_010907398.1.19996 WP_010907398.1.4808 WP_010907398.1.66990 WP_010907398.1.89773 WP_010907398.1.9947 gi|15603758|ref|NP_246832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]