SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603763|ref|NP_246837.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603763|ref|NP_246837.1|
Domain Number 1 Region: 16-209
Classification Level Classification E-value
Superfamily FKBP-like 1.69e-56
Family FKBP immunophilin/proline isomerase 0.00000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603763|ref|NP_246837.1|
Sequence length 210
Comment hypothetical protein PM1898 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSQQFFDQVSLESLSAKGSYGIGLQIGQQLLESQLEVSAEAVAKGIFDVLNQNPPALELN
EVSHALQTLQQQATEAQQAKFKEIEAVGAQFLAENAQKAGVNTTESGLQYEVLVAGEGQI
PAREDKVRVHYTGTLIDGTVFDSSVKRGQPAEFPVNGVIAGWIEALSMMPVGSKWRLTIP
HNLAYGERGAGASIPPFSTLVFEVELLAIL
Download sequence
Identical sequences A0A1D7R6A2 Q9CJU3 V4NIA8
gi|15603763|ref|NP_246837.1| WP_005724987.1.10027 WP_005724987.1.10721 WP_005724987.1.11014 WP_005724987.1.11214 WP_005724987.1.11947 WP_005724987.1.12156 WP_005724987.1.12311 WP_005724987.1.1307 WP_005724987.1.14908 WP_005724987.1.15732 WP_005724987.1.17217 WP_005724987.1.17980 WP_005724987.1.19996 WP_005724987.1.20287 WP_005724987.1.21657 WP_005724987.1.22153 WP_005724987.1.2313 WP_005724987.1.23830 WP_005724987.1.24757 WP_005724987.1.26616 WP_005724987.1.26777 WP_005724987.1.27416 WP_005724987.1.28084 WP_005724987.1.29697 WP_005724987.1.30617 WP_005724987.1.34253 WP_005724987.1.35562 WP_005724987.1.35978 WP_005724987.1.36022 WP_005724987.1.3807 WP_005724987.1.38246 WP_005724987.1.3839 WP_005724987.1.39152 WP_005724987.1.3957 WP_005724987.1.40210 WP_005724987.1.40787 WP_005724987.1.41351 WP_005724987.1.41462 WP_005724987.1.41667 WP_005724987.1.4211 WP_005724987.1.42469 WP_005724987.1.42943 WP_005724987.1.43687 WP_005724987.1.44741 WP_005724987.1.45422 WP_005724987.1.47685 WP_005724987.1.4808 WP_005724987.1.49053 WP_005724987.1.50853 WP_005724987.1.51342 WP_005724987.1.52066 WP_005724987.1.52585 WP_005724987.1.52859 WP_005724987.1.53852 WP_005724987.1.55074 WP_005724987.1.55401 WP_005724987.1.57420 WP_005724987.1.58257 WP_005724987.1.58450 WP_005724987.1.58628 WP_005724987.1.58910 WP_005724987.1.59455 WP_005724987.1.60478 WP_005724987.1.60664 WP_005724987.1.61098 WP_005724987.1.61860 WP_005724987.1.62016 WP_005724987.1.6219 WP_005724987.1.62389 WP_005724987.1.6332 WP_005724987.1.63549 WP_005724987.1.65482 WP_005724987.1.65878 WP_005724987.1.66934 WP_005724987.1.66990 WP_005724987.1.70689 WP_005724987.1.72215 WP_005724987.1.73917 WP_005724987.1.74955 WP_005724987.1.75804 WP_005724987.1.78987 WP_005724987.1.79347 WP_005724987.1.79593 WP_005724987.1.80223 WP_005724987.1.80589 WP_005724987.1.80911 WP_005724987.1.81885 WP_005724987.1.8281 WP_005724987.1.83579 WP_005724987.1.86541 WP_005724987.1.87897 WP_005724987.1.88402 WP_005724987.1.89773 WP_005724987.1.90081 WP_005724987.1.90179 WP_005724987.1.90578 WP_005724987.1.91495 WP_005724987.1.92478 WP_005724987.1.93940 WP_005724987.1.94435 WP_005724987.1.95718 WP_005724987.1.9746 WP_005724987.1.9947 272843.PM1898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]