SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603770|ref|NP_246844.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603770|ref|NP_246844.1|
Domain Number 1 Region: 30-250
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.14e-78
Family Carbonic anhydrase 0.0000000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603770|ref|NP_246844.1|
Sequence length 252
Comment hypothetical protein PM1905 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKSNLFVLTLGALALTACTSPLKKEETHTHWGYTGHESPEHWAELSPKFRICGEGKNQT
PIDIKHTIDGKLAPIKLDYRPSNVEIVNNGHTIQVDFKEASNRMQLNGKTFTLKQFHFHV
PSENLIRGKSFPMEAHFVHADNEGNLAVLGVLYVLSSENQRLAPIWQNFPQKAGEKYTLS
TAFDPATLIPKKRDYYRFSGSLTTPPCSEGVNWLVLKHYDNISQSQVEAFATLMKGHNNR
PVQPINARVIVE
Download sequence
Identical sequences A0A2J9R8L3 Q9CJT6
gi|15603770|ref|NP_246844.1| WP_005755530.1.12311 WP_005755530.1.14908 WP_005755530.1.15732 WP_005755530.1.19996 WP_005755530.1.24757 WP_005755530.1.3957 WP_005755530.1.40210 WP_005755530.1.40787 WP_005755530.1.45422 WP_005755530.1.4808 WP_005755530.1.53852 WP_005755530.1.61098 WP_005755530.1.6219 WP_005755530.1.62389 WP_005755530.1.66990 WP_005755530.1.81885 WP_005755530.1.8281 WP_005755530.1.89773 WP_005755530.1.9746 WP_005755530.1.9947 272843.PM1905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]