SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603775|ref|NP_246849.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603775|ref|NP_246849.1|
Domain Number 1 Region: 36-541
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.41e-138
Family Phosphate binding protein-like 0.0000000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603775|ref|NP_246849.1|
Sequence length 548
Comment hypothetical protein PM1910 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTNTMKKTGLNVALASIFTLFATQTTFAAEVPAGTELAAKQELRWNIGSNPASLDPHKIE
GTPEGFTSRQLFETLVISDAEGHIIPGAAIKWEHSPDFKKWTFHLRPDAKWSNGEPVTAE
DFVFSFQRLADPNTASPYSSYLKYLKLLNAEDVVAGKKPITELGVKALDAHTLELTLSAS
VPYADKLTEHYVLAPVNKKLVEQFGDKWTDVKNIVGNGAFTVKNWTINEKLELVPNPHYW
DHAKTVLTSVTLYPIESENTDVARYRAGDLDITNHALPVELFSKLKQEYPNEVYTPASLC
TYLYEINHKKPPFDDVRVRKALAMALDRDIITEKVTAQGQVPAYSFTPPYINGGEKIEKP
DWVALPQAERNKQAVALLKEAGFDKSNPLNFTLLYNTSENHKKIALAASSLWQKNLAGAV
KVTLENKEWKTYLDTRHQGNYQVTRAGWCADYNEASTFLNYFLSTSSNNTAFYKSAEFDK
LLSETYLAETDAQRAEIYAKLEAQLAKDAALVPVYYYVDPRMVKPYVKGFPINHPGKNFY
LKDVYLVK
Download sequence
Identical sequences A0A1D7R616 Q9CJT1 V4NAK3
gi|386835043|ref|YP_006240360.1| gi|15603775|ref|NP_246849.1| WP_005755533.1.10027 WP_005755533.1.10721 WP_005755533.1.12311 WP_005755533.1.1307 WP_005755533.1.14908 WP_005755533.1.15732 WP_005755533.1.17217 WP_005755533.1.18123 WP_005755533.1.19996 WP_005755533.1.20287 WP_005755533.1.21657 WP_005755533.1.22153 WP_005755533.1.2313 WP_005755533.1.23830 WP_005755533.1.26616 WP_005755533.1.26777 WP_005755533.1.27416 WP_005755533.1.27592 WP_005755533.1.29697 WP_005755533.1.30617 WP_005755533.1.34253 WP_005755533.1.35978 WP_005755533.1.36022 WP_005755533.1.39152 WP_005755533.1.3957 WP_005755533.1.40210 WP_005755533.1.40787 WP_005755533.1.41351 WP_005755533.1.41462 WP_005755533.1.41657 WP_005755533.1.41667 WP_005755533.1.42512 WP_005755533.1.42943 WP_005755533.1.44741 WP_005755533.1.45422 WP_005755533.1.47685 WP_005755533.1.4808 WP_005755533.1.50853 WP_005755533.1.51342 WP_005755533.1.52066 WP_005755533.1.53852 WP_005755533.1.55074 WP_005755533.1.57420 WP_005755533.1.58111 WP_005755533.1.58450 WP_005755533.1.58628 WP_005755533.1.58910 WP_005755533.1.59455 WP_005755533.1.60664 WP_005755533.1.61098 WP_005755533.1.61860 WP_005755533.1.62016 WP_005755533.1.6219 WP_005755533.1.62389 WP_005755533.1.65482 WP_005755533.1.65878 WP_005755533.1.66934 WP_005755533.1.66990 WP_005755533.1.73917 WP_005755533.1.74955 WP_005755533.1.75804 WP_005755533.1.79593 WP_005755533.1.80223 WP_005755533.1.80589 WP_005755533.1.80911 WP_005755533.1.81885 WP_005755533.1.86541 WP_005755533.1.87897 WP_005755533.1.88402 WP_005755533.1.89773 WP_005755533.1.90081 WP_005755533.1.90179 WP_005755533.1.91495 WP_005755533.1.92478 WP_005755533.1.93940 WP_005755533.1.94432 WP_005755533.1.94435 WP_005755533.1.95718 WP_005755533.1.9746 WP_005755533.1.9947 gi|378775031|ref|YP_005177274.1| 272843.PM1910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]