SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603781|ref|NP_246855.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603781|ref|NP_246855.1|
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.06e-86
Family Tyrosine-dependent oxidoreductases 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603781|ref|NP_246855.1|
Sequence length 242
Comment 3-ketoacyl-ACP reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQGKIALVTGATRGIGRAIAEELSAKGAFVIGTATSEKGAESISAYLGEKGKGLVLNVSD
LASIETTLEKIKADFGEIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAML
RSMMKKRFGRIITIGSVVGSMGNPGQTNYCAAKAGLIGFSKALAKEVASRGITVNVVAPG
FIATDMTDVLTEEQKAGILSQVPAGRLGDPKDIAKAVAFLASDDAGYITGTTLHVNGGMY
TN
Download sequence
Identical sequences A0A1D7R630 J5KEJ3 Q9CJS6 V4MVB8
gi|378775025|ref|YP_005177268.1| 272843.PM1916 WP_005725020.1.10027 WP_005725020.1.10721 WP_005725020.1.11214 WP_005725020.1.11947 WP_005725020.1.12156 WP_005725020.1.12311 WP_005725020.1.1307 WP_005725020.1.15732 WP_005725020.1.17217 WP_005725020.1.18123 WP_005725020.1.19996 WP_005725020.1.20287 WP_005725020.1.21657 WP_005725020.1.22153 WP_005725020.1.2313 WP_005725020.1.23830 WP_005725020.1.26616 WP_005725020.1.27416 WP_005725020.1.27592 WP_005725020.1.28084 WP_005725020.1.29697 WP_005725020.1.30617 WP_005725020.1.34253 WP_005725020.1.35562 WP_005725020.1.35978 WP_005725020.1.36022 WP_005725020.1.3807 WP_005725020.1.38246 WP_005725020.1.3839 WP_005725020.1.39152 WP_005725020.1.40210 WP_005725020.1.41351 WP_005725020.1.41462 WP_005725020.1.41657 WP_005725020.1.41667 WP_005725020.1.4211 WP_005725020.1.42512 WP_005725020.1.42943 WP_005725020.1.43687 WP_005725020.1.44741 WP_005725020.1.45422 WP_005725020.1.47685 WP_005725020.1.4808 WP_005725020.1.49053 WP_005725020.1.50853 WP_005725020.1.51342 WP_005725020.1.52066 WP_005725020.1.52585 WP_005725020.1.52859 WP_005725020.1.53852 WP_005725020.1.55401 WP_005725020.1.57420 WP_005725020.1.57956 WP_005725020.1.58111 WP_005725020.1.58257 WP_005725020.1.58450 WP_005725020.1.58628 WP_005725020.1.58910 WP_005725020.1.59455 WP_005725020.1.60478 WP_005725020.1.60664 WP_005725020.1.61860 WP_005725020.1.62016 WP_005725020.1.6219 WP_005725020.1.62389 WP_005725020.1.6332 WP_005725020.1.63549 WP_005725020.1.65482 WP_005725020.1.65878 WP_005725020.1.66934 WP_005725020.1.66990 WP_005725020.1.70689 WP_005725020.1.72215 WP_005725020.1.73917 WP_005725020.1.74955 WP_005725020.1.75804 WP_005725020.1.78987 WP_005725020.1.79347 WP_005725020.1.80223 WP_005725020.1.80589 WP_005725020.1.80911 WP_005725020.1.81885 WP_005725020.1.8281 WP_005725020.1.83579 WP_005725020.1.86541 WP_005725020.1.87897 WP_005725020.1.88402 WP_005725020.1.89773 WP_005725020.1.90081 WP_005725020.1.90179 WP_005725020.1.91495 WP_005725020.1.92478 WP_005725020.1.93940 WP_005725020.1.94432 WP_005725020.1.94435 WP_005725020.1.95718 WP_005725020.1.9746 WP_005725020.1.9947 gi|386835037|ref|YP_006240354.1| gi|15603781|ref|NP_246855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]