SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603798|ref|NP_246872.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603798|ref|NP_246872.1|
Domain Number 1 Region: 123-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.13e-54
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000114
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 6.23e-41
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603798|ref|NP_246872.1|
Sequence length 284
Comment bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTAQVISGTELSKTIKSQVAQKIETYTQQGKRSPGLAVILVGADPASQVYVGSKRKSCAE
IGIQSKSYDLPETTQESELLALIDELNADTTVDGILVQLPLPKHIDSTKVIERITPEKDV
DGFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIDLHGKHAVIVGASNIVGRPMALELL
LAGCTVTVTHRFTKDLAHHVRQADILVVAVGKPKFIPGDWIKAGAIVIDVGINRQEGKLV
GDVEYDVALEKAGYITPVPGGVGPMTVAMLMFNTLSAYEMKIAS
Download sequence
Identical sequences A0A1E3XHI4 Q9CJR1
272843.PM1933 gi|378775007|ref|YP_005177250.1| WP_005725034.1.10027 WP_005725034.1.10721 WP_005725034.1.11014 WP_005725034.1.12311 WP_005725034.1.1307 WP_005725034.1.15732 WP_005725034.1.17217 WP_005725034.1.18123 WP_005725034.1.19996 WP_005725034.1.20287 WP_005725034.1.21657 WP_005725034.1.22153 WP_005725034.1.2313 WP_005725034.1.24757 WP_005725034.1.26616 WP_005725034.1.26777 WP_005725034.1.27416 WP_005725034.1.29697 WP_005725034.1.30617 WP_005725034.1.34253 WP_005725034.1.35978 WP_005725034.1.39152 WP_005725034.1.40210 WP_005725034.1.40787 WP_005725034.1.41351 WP_005725034.1.41462 WP_005725034.1.41667 WP_005725034.1.42469 WP_005725034.1.42943 WP_005725034.1.44741 WP_005725034.1.45422 WP_005725034.1.47685 WP_005725034.1.4808 WP_005725034.1.50853 WP_005725034.1.51342 WP_005725034.1.52066 WP_005725034.1.53852 WP_005725034.1.57420 WP_005725034.1.58111 WP_005725034.1.58450 WP_005725034.1.58628 WP_005725034.1.58910 WP_005725034.1.59455 WP_005725034.1.60664 WP_005725034.1.61860 WP_005725034.1.62016 WP_005725034.1.6219 WP_005725034.1.62389 WP_005725034.1.65482 WP_005725034.1.65878 WP_005725034.1.66934 WP_005725034.1.66990 WP_005725034.1.70689 WP_005725034.1.73917 WP_005725034.1.75804 WP_005725034.1.80223 WP_005725034.1.80589 WP_005725034.1.80911 WP_005725034.1.8281 WP_005725034.1.86541 WP_005725034.1.87897 WP_005725034.1.88402 WP_005725034.1.89773 WP_005725034.1.90081 WP_005725034.1.90179 WP_005725034.1.90578 WP_005725034.1.91495 WP_005725034.1.92478 WP_005725034.1.93940 WP_005725034.1.94435 WP_005725034.1.9746 WP_005725034.1.9947 gi|15603798|ref|NP_246872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]