SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603800|ref|NP_246874.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603800|ref|NP_246874.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000898
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603800|ref|NP_246874.1|
Sequence length 70
Comment hypothetical protein PM1935 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKINVAIVGSGYSTRIFHVPFFKNDHRFNVIKFFERSTTRALAWFPNIDIVSNFEKLLT
DEVDLIVISQ
Download sequence
Identical sequences A0A0E3V3Z7 A0A1V3KJG6 A0A2J9QNB3 A4N4Q6 F9GNK6 Q9CJQ9
WP_005628486.1.12311 WP_005628486.1.12713 WP_005628486.1.15732 WP_005628486.1.17980 WP_005628486.1.19996 WP_005628486.1.36515 WP_005628486.1.3733 WP_005628486.1.40210 WP_005628486.1.40503 WP_005628486.1.4211 WP_005628486.1.45422 WP_005628486.1.4808 WP_005628486.1.53852 WP_005628486.1.55074 WP_005628486.1.6054 WP_005628486.1.6219 WP_005628486.1.62389 WP_005628486.1.66990 WP_005628486.1.68713 WP_005628486.1.73473 WP_005628486.1.76422 WP_005628486.1.79564 WP_005628486.1.81885 WP_005628486.1.8281 WP_005628486.1.89773 WP_005628486.1.91688 WP_005628486.1.92519 WP_005628486.1.9746 WP_005628486.1.98200 WP_005628486.1.9947 272843.PM1935 gi|15603800|ref|NP_246874.1| gi|386265353|ref|YP_005828845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]