SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603805|ref|NP_246879.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603805|ref|NP_246879.1|
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.55e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603805|ref|NP_246879.1|
Sequence length 236
Comment hypothetical protein PM1940 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSLFLLRWNGAMLKLDLGLRSSNLKKFYHLKIFLKILLLVVEICQRTITVQKGDFVVLGG
ATSSVGIATIQIAKMQGANVIALSRTHAKGDVLLQKGADFVIATKEDDVTAKLLEITNGK
GVNLVFDPVGGKEAAKIINAMTQDGKYIIYGALSHDDIAVPVFPILGKHLTVRGYELFEI
TTVPEKLAQAKKFVFDGLASGQLKPEIDKVFAFDEMAEAHRYMESNAQIGKILVKV
Download sequence
Identical sequences Q9CJQ4
WP_010907410.1.12311 WP_010907410.1.15732 WP_010907410.1.19996 WP_010907410.1.40210 WP_010907410.1.45422 WP_010907410.1.4808 WP_010907410.1.53852 WP_010907410.1.55074 WP_010907410.1.6219 WP_010907410.1.62389 WP_010907410.1.66990 WP_010907410.1.81885 WP_010907410.1.8281 WP_010907410.1.89773 WP_010907410.1.9746 WP_010907410.1.9947 272843.PM1940 gi|15603805|ref|NP_246879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]