SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603806|ref|NP_246880.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603806|ref|NP_246880.1|
Domain Number 1 Region: 5-127
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.97e-34
Family DNA-binding N-terminal domain of transcription activators 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603806|ref|NP_246880.1|
Sequence length 132
Comment hypothetical protein PM1941 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKFFKIKQASEQTGVHLETIRYYEKQGLIAPTHQQNGYRVFDENQLEQLRFIKTCRNIG
LSLSNIKTLLQLQQTPNKQCNEINALAEQHLAYLDEQITELQQVKTFLMQFVGCENKTVD
KCQIIQGIKEKE
Download sequence
Identical sequences A0A0E3V3Z3 A0A1B8Q7R7 A0A1T0BB57 A0A1V3IC44 A0A1V3IZK0 A0A1V3K204 A0A1V3L8D5 A0A2J9QMM2 Q9CJQ3
272843.PM1941 gi|15603806|ref|NP_246880.1| WP_010907411.1.12311 WP_010907411.1.15732 WP_010907411.1.17980 WP_010907411.1.18765 WP_010907411.1.19996 WP_010907411.1.20949 WP_010907411.1.25285 WP_010907411.1.29092 WP_010907411.1.32159 WP_010907411.1.39462 WP_010907411.1.40210 WP_010907411.1.4211 WP_010907411.1.45422 WP_010907411.1.4808 WP_010907411.1.53852 WP_010907411.1.54891 WP_010907411.1.55074 WP_010907411.1.61752 WP_010907411.1.6219 WP_010907411.1.62389 WP_010907411.1.66990 WP_010907411.1.79232 WP_010907411.1.81885 WP_010907411.1.8281 WP_010907411.1.89773 WP_010907411.1.91688 WP_010907411.1.92519 WP_010907411.1.9746 WP_010907411.1.98803 WP_010907411.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]