SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603810|ref|NP_246884.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603810|ref|NP_246884.1|
Domain Number 1 Region: 46-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000127
Family LysR-like transcriptional regulators 0.04
Further Details:      
 
Weak hits

Sequence:  gi|15603810|ref|NP_246884.1|
Domain Number - Region: 101-144
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000235
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603810|ref|NP_246884.1|
Sequence length 147
Comment protein YcaN [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLACIVFIGVIITRNFNISSMIEMFFNCPKPPFQIQKPTSHFSLFLSHSMKNLETRLNLR
LFNRTTRNVSLTEAGQQFFEQLLPLYQAINQEVDALNDFLNTPSGLIRINAPAMAAEAVL
YPKLKPILNQYPKTRLEIVVDDRWQIL
Download sequence
Identical sequences Q9CJP9
272843.PM1945 gi|15603810|ref|NP_246884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]