SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603812|ref|NP_246886.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603812|ref|NP_246886.1|
Domain Number 1 Region: 204-287,408-501
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000074
Family Lambda integrase-like, catalytic core 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603812|ref|NP_246886.1|
Sequence length 678
Comment hypothetical protein PM1947 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNNLIFTPQDNNPKSNLEQFINFSKNQLTTFGNDCWENNQWKTTFSIYPVQVRFSTERIK
STAYKYEPLAAPFIEFAKAYIRYTYSLNPIRNLARHTESLRIVEMALYNIKGKADILQLD
YLVIHEVENIVSKKYKKGTESVNKLGYQIQKLFDFCRENQITPQLPLWKSPYKRPRDLTI
LLDEKGKEYRSSKMPTDEEMMLVAKLFHDAPNLDKETEYYTAVMALLMVAPSRCSELMSL
SVNCLEWENDSLGNKQLGIRWIPAKNGKVGLKWVPSCMQDIVVEAVKRLTNIGTLARGVA
KFAEENPNILMLSNKEAAPSRSLYQKPLTKSEIFEVLDIDKNSTNTKWFKNLISENDGII
TYEVLGKFLYKKYTSKFHNWPYVDKHKNVKVSEALLLFRENEFHDDFSPKSFSFVLPTVN
QINDRFCYSETRPKTSLWEKHCIGTSKGEFIRLPSHNARHWLSTKAERGGMDELTLANWA
GRARVADNKAYDHRTEEEKSESVRNLLIPEDISILDKIHLNLPITYEDLGKDRIGIATVT
EIGICEHDYAMSPCSRHGDCETCKELVCIKGLEHSLEILKVREAQITEQFNKAKEHHKIG
VFGADRWISNLGWRLTHIKTKIKFLENESIPNGSLLRMPDEYDPSPIKLALLERGMDLDI
QKKETAKLDDDLYRLMEL
Download sequence
Identical sequences A0A1S9ZT85 A0A2J9QNE0 Q9CJP7
gi|15603812|ref|NP_246886.1| 272843.PM1947 WP_010907417.1.12311 WP_010907417.1.15732 WP_010907417.1.19996 WP_010907417.1.26920 WP_010907417.1.40210 WP_010907417.1.4211 WP_010907417.1.45422 WP_010907417.1.4808 WP_010907417.1.53852 WP_010907417.1.55074 WP_010907417.1.6219 WP_010907417.1.62389 WP_010907417.1.66990 WP_010907417.1.81885 WP_010907417.1.8281 WP_010907417.1.89773 WP_010907417.1.9746 WP_010907417.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]