SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603814|ref|NP_246888.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603814|ref|NP_246888.1|
Domain Number 1 Region: 210-403
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.92e-16
Family Lambda integrase-like, catalytic core 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603814|ref|NP_246888.1|
Sequence length 428
Comment hypothetical protein PM1949 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIMHRLETVLFSNGERFPILVNVKTGIPDFYSTLWVTVELRNQSAVNTIRNKLGTIQWVM
NWEKQNNLVISDLIHNKALLTENQLESLIQHMRINVKKRKNVINTKKSVLMKGRTQFIDI
YSAVSLSHQYNRLTTLSEYILFLSKVINVSNEYIEKLTKLITLIKESRPKNHKTLSIKPE
SELPDGLLDEFMSIANFSNPNNPFQDIGIRKRNHLMFILLKELGIRRGELLSIQIPFIDI
GTAKSSITIRRTHDDKFDTRKKQAVSKTKERRLPISQNIAQLINDYIMNYRSKIPNANKH
PYLFVTHRKGKTQGNPISTSSFDNVIVPTMKKIDSKFSIIHPHIFRHEWNLDFSRKVDKN
NQNVNHDSSHKDFISPEKEAKMRQHLMGHTSEKSGNIYNQRYIREKANKILLDLQIQFQK
KVDNYESE
Download sequence
Identical sequences F9GNN7 Q9CJP5
272843.PM1949 gi|15603814|ref|NP_246888.1| gi|386265369|ref|YP_005828861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]