SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603826|ref|NP_246900.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603826|ref|NP_246900.1|
Domain Number 1 Region: 2-357
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 8.64e-123
Family Dimeric isocitrate & isopropylmalate dehydrogenases 0.00000000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603826|ref|NP_246900.1|
Sequence length 359
Comment 3-isopropylmalate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQTFNIAVLSGDGIGPEIIAEAIKVLDVVQQKYAFKLNYRTFDVGGIAIDNHGTPLPEAT
LKGCEESDAILFGSVGGPKWEHLPPAQQPERGALLPLRKHFALFCNLRPATLYKGLEKFC
PLRADISAKGFDMVTVRELTGGIYFGQPKGREGEGANEKAFDTEVYHRYEIERIARVAFE
TAMKRSKHVTSVDKANVLISSVLWREVVCDVAKDYPEVTLDHIYIDNATMQLIKQPEFFD
VLLCSNIFGDIISDECAMITGSMGMLPSASLNEKGFGLYEPAGGSAPDIAGKGIANPIAQ
ILSAAMMLRHSFNLNDAATAIENAVKNVLAEGHRTADLADESQPLSTKQMGDLIAQAVE
Download sequence
Identical sequences Q9CJN6
gi|15603826|ref|NP_246900.1| 272843.PM1961 WP_010907425.1.12311 WP_010907425.1.15732 WP_010907425.1.19996 WP_010907425.1.40210 WP_010907425.1.45422 WP_010907425.1.4808 WP_010907425.1.53852 WP_010907425.1.6219 WP_010907425.1.62389 WP_010907425.1.66990 WP_010907425.1.81885 WP_010907425.1.8281 WP_010907425.1.89773 WP_010907425.1.9746 WP_010907425.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]