SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603827|ref|NP_246901.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603827|ref|NP_246901.1|
Domain Number 1 Region: 2-292
Classification Level Classification E-value
Superfamily Aldolase 8.06e-100
Family HMGL-like 0.00037
Further Details:      
 
Domain Number 2 Region: 405-501
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 5.89e-24
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603827|ref|NP_246901.1|
Sequence length 518
Comment 2-isopropylmalate synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MADNIIIFDTTLRDGEQALKASLTVKEKLQIAFALERLGVDVMEVGFPISSAGDFESVQT
IARHIKHSRVCALSRAVDKDIDAAAEALKVAEAFRIHTFIATSALHVEAKLRRTFEDVVD
MAINAVKRARNYTDDVEFSCEDAGRTGVDNICRIVEAAIKAGATTVNIPDTVGYCLPYQY
GDIIANVMNRVPNIDKAIISVHCHNDLGMATANSLTAVQNGARQIECTINGIGERAGNTA
LEEVVMAIKTRQDMFNGLDTRINTQEIHRVSQMVSQLCNMPIQPNKAIVGSNAFAHSSGI
HQDGMVKHKNTYEIMSPESIGLKKEKLNLTARSGRAAVKNHMSEMGYQESDYDLDKLYEA
FLKLADKKGQVFDYDLEALAFIDMQQGDEDRLTLDVITSQCISHLPASAFVQVELDGKKM
SQVSNGGNGPVDAVYNAILAITGLEMKMLNYNLTAKGEGAEALGQVDIVVEHEGRRFHGV
GLATDIVESSARALIHAINAIYRSQKVADLKLHKIAGV
Download sequence
Identical sequences Q9CJN5
gi|15603827|ref|NP_246901.1| 272843.PM1962 WP_010907426.1.12311 WP_010907426.1.15732 WP_010907426.1.19996 WP_010907426.1.40210 WP_010907426.1.45422 WP_010907426.1.4808 WP_010907426.1.53852 WP_010907426.1.6219 WP_010907426.1.62389 WP_010907426.1.66990 WP_010907426.1.81885 WP_010907426.1.8281 WP_010907426.1.89773 WP_010907426.1.9746 WP_010907426.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]