SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603833|ref|NP_246907.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603833|ref|NP_246907.1|
Domain Number 1 Region: 3-258
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.05e-64
Family Tyrosine-dependent oxidoreductases 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603833|ref|NP_246907.1|
Sequence length 259
Comment sorbitol-6-phosphate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKVAVVIGGGQTLGAFLSEGLAEAGYRVVVADLNGENAKQVATRINTQQGIGHAIGLQV
DAADETSVETLVHATDQAFGKIDLLVYSAGTAKASPIYDFDLKDFDLSVKVNLTGYFLCA
KHFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLADYGITVH
SLMLGNLLKSPMFQSLIPQYAKKLGIPEEEVEQVYIDKVPLKRGCDYQDVLNVLKFYASE
EASYCTGQSINITGGQVMF
Download sequence
Identical sequences A0A1E3XP48 A0A2K2YXG3 Q9CJM9
WP_005719474.1.11214 WP_005719474.1.11947 WP_005719474.1.12156 WP_005719474.1.12311 WP_005719474.1.14908 WP_005719474.1.15732 WP_005719474.1.17980 WP_005719474.1.19996 WP_005719474.1.21657 WP_005719474.1.24757 WP_005719474.1.26777 WP_005719474.1.27592 WP_005719474.1.27664 WP_005719474.1.28084 WP_005719474.1.35562 WP_005719474.1.36022 WP_005719474.1.3807 WP_005719474.1.38246 WP_005719474.1.3839 WP_005719474.1.3957 WP_005719474.1.40210 WP_005719474.1.40787 WP_005719474.1.41297 WP_005719474.1.41351 WP_005719474.1.41657 WP_005719474.1.41667 WP_005719474.1.4211 WP_005719474.1.42512 WP_005719474.1.43687 WP_005719474.1.45422 WP_005719474.1.4808 WP_005719474.1.49053 WP_005719474.1.51342 WP_005719474.1.52585 WP_005719474.1.53852 WP_005719474.1.55074 WP_005719474.1.55401 WP_005719474.1.57956 WP_005719474.1.58111 WP_005719474.1.58257 WP_005719474.1.60478 WP_005719474.1.61098 WP_005719474.1.6219 WP_005719474.1.62389 WP_005719474.1.6332 WP_005719474.1.63549 WP_005719474.1.66990 WP_005719474.1.70689 WP_005719474.1.78987 WP_005719474.1.79347 WP_005719474.1.79593 WP_005719474.1.81885 WP_005719474.1.8281 WP_005719474.1.83579 WP_005719474.1.88402 WP_005719474.1.89773 WP_005719474.1.92478 WP_005719474.1.93940 WP_005719474.1.94432 WP_005719474.1.95718 WP_005719474.1.9746 WP_005719474.1.9947 gi|383310952|ref|YP_005363762.1| gi|15603833|ref|NP_246907.1| 272843.PM1968 gi|386835000|ref|YP_006240317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]