SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603840|ref|NP_246914.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603840|ref|NP_246914.1|
Domain Number 1 Region: 248-429
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 2.94e-48
Family TF C-terminus 0.000000607
Further Details:      
 
Domain Number 2 Region: 89-240
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-39
Family FKBP immunophilin/proline isomerase 0.00000352
Further Details:      
 
Domain Number 3 Region: 1-131
Classification Level Classification E-value
Superfamily Trigger factor ribosome-binding domain 5.49e-39
Family Trigger factor ribosome-binding domain 0.00000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603840|ref|NP_246914.1|
Sequence length 432
Comment trigger factor [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSFTIETTQGLERRVQITVPADTVEGAVREELKRVAKTARVDGFRKGKVPPHIIEKRFGA
SVRHDVLGDVLQSHFFNVVMEQKVNLAGRPAFAVEQFEAGKDLVFTATFEVYPEVALQGL
DQIKVEKPVVEISEADIDKMIDVLRKQQATWAETAEAASAEDRVVIDFVGSVDGEVFEGG
KAEDFTLFMGQGRMIPGFEEGIVGHKAGEQFDIDVTFPEEYHAENLKGKAAKFAITLKKV
EVMVLPELTDEFVAKFGPNTKTVDDLRNEIRKNMQRELKNALTAKVKGQVIDGLLAQNAI
DVPASAVEQEIEVLRGQAAQRFGGNKEQAAQLPRELFEEQAKRRVQVGLLLAEVIASHEL
KVDEARAKTMIEEIASAYEQPAEVVEYYSKNKELMNNIRNVVLEEQAVDAVLAKAQVTEK
AASFDDVMNPQA
Download sequence
Identical sequences P57980
272843.PM1975 WP_010907432.1.12311 WP_010907432.1.15732 WP_010907432.1.19996 WP_010907432.1.40210 WP_010907432.1.45422 WP_010907432.1.4808 WP_010907432.1.53852 WP_010907432.1.6219 WP_010907432.1.62389 WP_010907432.1.66990 WP_010907432.1.81885 WP_010907432.1.8281 WP_010907432.1.89773 WP_010907432.1.9746 WP_010907432.1.9947 gi|15603840|ref|NP_246914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]