SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603843|ref|NP_246917.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603843|ref|NP_246917.1|
Domain Number 1 Region: 594-769
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-58
Family ATP-dependent protease Lon (La), catalytic domain 0.000000088
Further Details:      
 
Domain Number 2 Region: 312-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.97e-49
Family Extended AAA-ATPase domain 0.0000597
Further Details:      
 
Domain Number 3 Region: 10-201
Classification Level Classification E-value
Superfamily PUA domain-like 1.71e-45
Family LON domain-like 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603843|ref|NP_246917.1|
Sequence length 804
Comment hypothetical protein PM1978 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSAKKTQQQSIPVLPLRDVVVFPYMVMPLFVGRPKSIRSLDEAMETGKQLLLVSQKQADL
EEPTVDDVYRVGTVANIIQLLKLPDGTVKVLVEGQQRATIEQLDDNGEYFSAQIRLIETE
FGDDKELEVVKKATLAEFEKYAKLNKKVQPDVHAALERIEEFDRLSDTLAAHMPVAVKHK
QKVLEIAKVVARFEYLLGLMESETDLLQIEKRIRGRVKEQMEKTQRDYYLNEQIKAIQKE
LGEGDSADEIEQLRQKIEEAKMPAEAKSKAEAELQKLKMMSPMSAEATVVRSYIDWMIQV
PWHKRTKVKKDLTKAQQVLDADHYGLERVKERILEYLAVQTRLNQIKGPILCLVGPPGVG
KTSLGQSIAQATGRKYVRMALGGVRDEAEIRGHRKTYIGALPGKLIQKMAKVGVKNPLFL
LDEIDKMSSDMRGDPASALLEVLDPEQNTSFNDHYLEVDYDLSDVMFVATSNSMRIPAPL
LDRMEVIRLSGYTEDEKLNIATRHLIAKQMERNGLKAGELTIEDSAILDIIRYYTREAGV
RSLEREISKICRKAVKNLLLDKKVKSLKVNATNLHDYLGVKRFEFGRADTQNRVGEVTGL
AWTEVGGDLLTIETASVLGKGKLTYTGSLGDVMKESIQAAMTVVRSRAEKLGIASDFHEK
RDIHIHVPEGATPKDGPSAGIAMCTALVSCLTGNPVKADVAMTGEITLRGKVLPIGGLKE
KLLAAHRGGIKTVIIPKENVKDLEEIPDNAKSNLTIHAVETIDEVLTIALENAPTGVEFM
KLTPVSAAKTVRKGRSTSRKSAVN
Download sequence
Identical sequences A0A290LP72 Q9CJM1
WP_010907433.1.12311 WP_010907433.1.15732 WP_010907433.1.17980 WP_010907433.1.19996 WP_010907433.1.21657 WP_010907433.1.24757 WP_010907433.1.26777 WP_010907433.1.40210 WP_010907433.1.40787 WP_010907433.1.41351 WP_010907433.1.41667 WP_010907433.1.51342 WP_010907433.1.58111 WP_010907433.1.62389 WP_010907433.1.66990 WP_010907433.1.81885 WP_010907433.1.8281 WP_010907433.1.88402 WP_010907433.1.89773 WP_010907433.1.92478 WP_010907433.1.93940 WP_010907433.1.9947 272843.PM1978 gi|15603843|ref|NP_246917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]