SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603853|ref|NP_246927.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603853|ref|NP_246927.1|
Domain Number 1 Region: 132-280
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 7.19e-62
Family Dihydrodipicolinate reductase-like 0.00000119
Further Details:      
 
Domain Number 2 Region: 8-156
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.93e-48
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000362
Further Details:      
 
Domain Number 3 Region: 308-399
Classification Level Classification E-value
Superfamily 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 4.97e-31
Family 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603853|ref|NP_246927.1|
Sequence length 405
Comment 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSISYFMKKIVILGSTGSIGTSTLSVITHNPDKYQVFALVGGRNVELMFQQCLTFQPSFA
ALDDDVAAKMLAEKLKAHQSQTTVLAGQQAICELAAHPEADMVMAAIVGAAGLLPTLSAV
KAGKRVLLANKEALVTCGQLFIDAVRESQAQLLPVDSEHNAIFQSLPPEAQRQIGFCPLS
ELGISKIVLTGSGGPFRYTPLEQFEQITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIE
ARWLFNASAEEMEVIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMAYPSRTVAGV
EPLDFYQLNGLTFIEPDYQRYPCLKLAIDAFSAGQYATTAMNAANEIAVASFLDNKIKFT
DIARLNQLVVSKLQPQKIHCIEDVLEVDKKARELSQSIILSFSHP
Download sequence
Identical sequences P57985
gi|15603853|ref|NP_246927.1| 272843.PM1988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]