SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603858|ref|NP_246932.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603858|ref|NP_246932.1|
Domain Number 1 Region: 23-187
Classification Level Classification E-value
Superfamily OmpH-like 1.2e-27
Family OmpH-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603858|ref|NP_246932.1|
Sequence length 193
Comment hypothetical protein PM1993 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKAVKVTALSLALAFTSSLAMATENIAFISGDYLFQNHPDRKMVAEKLESEFKARVEKL
TANKKSIDEKIAASQKKVEAKVAALQKDAPKLRSADIKKREEEINKLGNSEQEAINKLVT
AHDEEVSKYQDDYAKREREETAKLVDSIQNAVNTVAREKNYTLVLNEGAVVFAADAKNIT
EDVLKVIPATQAK
Download sequence
Identical sequences A0A023SFY5 A0A2K2YXU5 Q51922 V4Q1R5
WP_005719521.1.10027 WP_005719521.1.10721 WP_005719521.1.11014 WP_005719521.1.11214 WP_005719521.1.11947 WP_005719521.1.12156 WP_005719521.1.12311 WP_005719521.1.1307 WP_005719521.1.14908 WP_005719521.1.15732 WP_005719521.1.17217 WP_005719521.1.17980 WP_005719521.1.18123 WP_005719521.1.19996 WP_005719521.1.20287 WP_005719521.1.21657 WP_005719521.1.22153 WP_005719521.1.2313 WP_005719521.1.23830 WP_005719521.1.24757 WP_005719521.1.26616 WP_005719521.1.26777 WP_005719521.1.27416 WP_005719521.1.27592 WP_005719521.1.27664 WP_005719521.1.28084 WP_005719521.1.29697 WP_005719521.1.30617 WP_005719521.1.34253 WP_005719521.1.35562 WP_005719521.1.35978 WP_005719521.1.36022 WP_005719521.1.3807 WP_005719521.1.38246 WP_005719521.1.3839 WP_005719521.1.39152 WP_005719521.1.3957 WP_005719521.1.40210 WP_005719521.1.40787 WP_005719521.1.41297 WP_005719521.1.41351 WP_005719521.1.41462 WP_005719521.1.41657 WP_005719521.1.41667 WP_005719521.1.42469 WP_005719521.1.42512 WP_005719521.1.42943 WP_005719521.1.43687 WP_005719521.1.44741 WP_005719521.1.45422 WP_005719521.1.47685 WP_005719521.1.4808 WP_005719521.1.49053 WP_005719521.1.50853 WP_005719521.1.51342 WP_005719521.1.52066 WP_005719521.1.52585 WP_005719521.1.53852 WP_005719521.1.55401 WP_005719521.1.57420 WP_005719521.1.57956 WP_005719521.1.58111 WP_005719521.1.58257 WP_005719521.1.58450 WP_005719521.1.58628 WP_005719521.1.58910 WP_005719521.1.59455 WP_005719521.1.60478 WP_005719521.1.60664 WP_005719521.1.61098 WP_005719521.1.61860 WP_005719521.1.62016 WP_005719521.1.6219 WP_005719521.1.62389 WP_005719521.1.6332 WP_005719521.1.63549 WP_005719521.1.65482 WP_005719521.1.65878 WP_005719521.1.66934 WP_005719521.1.66990 WP_005719521.1.72215 WP_005719521.1.73917 WP_005719521.1.74955 WP_005719521.1.75804 WP_005719521.1.78987 WP_005719521.1.79347 WP_005719521.1.79593 WP_005719521.1.80223 WP_005719521.1.80589 WP_005719521.1.80911 WP_005719521.1.81885 WP_005719521.1.8281 WP_005719521.1.83579 WP_005719521.1.86541 WP_005719521.1.87897 WP_005719521.1.88402 WP_005719521.1.89773 WP_005719521.1.90081 WP_005719521.1.90179 WP_005719521.1.90578 WP_005719521.1.91495 WP_005719521.1.92478 WP_005719521.1.93940 WP_005719521.1.94432 WP_005719521.1.94435 WP_005719521.1.95718 WP_005719521.1.9746 WP_005719521.1.9947 gi|383310927|ref|YP_005363737.1| gi|378774963|ref|YP_005177206.1| 272843.PM1993 gi|386834975|ref|YP_006240292.1| gi|15603858|ref|NP_246932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]