SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603863|ref|NP_246937.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603863|ref|NP_246937.1|
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.71e-69
Family Ribonuclease H 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15603863|ref|NP_246937.1|
Sequence length 197
Comment ribonuclease HII [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVFEYPKGVELIAGVDEVGRGPLVGAVVTAAVILDPHQPILGLNDSKKLSEKKRLLLAEE
IKQKALAWSLGRAEAEEIDQLNILHATMLAMKRAVENLKIQPHFVLVDGNRVPELMIPAQ
AIVKGDGLVAEISAASILAKVARDQEMAELDKRYPEYAFAQHKGYPTALHLAKLAELGPL
AQHRRSFAPVRKLLNTL
Download sequence
Identical sequences A0A1E3XH29 A0A2K2YXC4 P57986 V4Q1R9
WP_005725099.1.10027 WP_005725099.1.10721 WP_005725099.1.11014 WP_005725099.1.11214 WP_005725099.1.11947 WP_005725099.1.12156 WP_005725099.1.12311 WP_005725099.1.1307 WP_005725099.1.14908 WP_005725099.1.15732 WP_005725099.1.17217 WP_005725099.1.17980 WP_005725099.1.18123 WP_005725099.1.19996 WP_005725099.1.20287 WP_005725099.1.21657 WP_005725099.1.22153 WP_005725099.1.2313 WP_005725099.1.23830 WP_005725099.1.26616 WP_005725099.1.26777 WP_005725099.1.27416 WP_005725099.1.27592 WP_005725099.1.27664 WP_005725099.1.28084 WP_005725099.1.29697 WP_005725099.1.30617 WP_005725099.1.34253 WP_005725099.1.35562 WP_005725099.1.35978 WP_005725099.1.36022 WP_005725099.1.3807 WP_005725099.1.38246 WP_005725099.1.3839 WP_005725099.1.39152 WP_005725099.1.3957 WP_005725099.1.40210 WP_005725099.1.41297 WP_005725099.1.41351 WP_005725099.1.41462 WP_005725099.1.41657 WP_005725099.1.41667 WP_005725099.1.42469 WP_005725099.1.42512 WP_005725099.1.42943 WP_005725099.1.43687 WP_005725099.1.44741 WP_005725099.1.45422 WP_005725099.1.47685 WP_005725099.1.4808 WP_005725099.1.49053 WP_005725099.1.50853 WP_005725099.1.51342 WP_005725099.1.52066 WP_005725099.1.53852 WP_005725099.1.55401 WP_005725099.1.57420 WP_005725099.1.57956 WP_005725099.1.58111 WP_005725099.1.58257 WP_005725099.1.58450 WP_005725099.1.58628 WP_005725099.1.58910 WP_005725099.1.59455 WP_005725099.1.60478 WP_005725099.1.60664 WP_005725099.1.61098 WP_005725099.1.61860 WP_005725099.1.62016 WP_005725099.1.6219 WP_005725099.1.62389 WP_005725099.1.6332 WP_005725099.1.63549 WP_005725099.1.65482 WP_005725099.1.65878 WP_005725099.1.66934 WP_005725099.1.66990 WP_005725099.1.70689 WP_005725099.1.72215 WP_005725099.1.73917 WP_005725099.1.74955 WP_005725099.1.75804 WP_005725099.1.78987 WP_005725099.1.79347 WP_005725099.1.79593 WP_005725099.1.80223 WP_005725099.1.80589 WP_005725099.1.80911 WP_005725099.1.81885 WP_005725099.1.8281 WP_005725099.1.83579 WP_005725099.1.86541 WP_005725099.1.87897 WP_005725099.1.88402 WP_005725099.1.89773 WP_005725099.1.90081 WP_005725099.1.90179 WP_005725099.1.90578 WP_005725099.1.91495 WP_005725099.1.92478 WP_005725099.1.93940 WP_005725099.1.94432 WP_005725099.1.94435 WP_005725099.1.95718 WP_005725099.1.9746 WP_005725099.1.9947 gi|15603863|ref|NP_246937.1| 272843.PM1998 gi|383310922|ref|YP_005363732.1| gi|378774958|ref|YP_005177201.1| gi|386834969|ref|YP_006240286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]