SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603872|ref|NP_246946.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603872|ref|NP_246946.1|
Domain Number 1 Region: 126-344
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000000000471
Family MoCo biosynthesis proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603872|ref|NP_246946.1|
Sequence length 394
Comment ribosomal RNA large subunit methyltransferase N [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLEQQTCAEKAANTVNTVELSTDQAKKINLMNLTRQQMREFFKELGEKPFRADQLVKWIY
HFGEDNFDNMTNINKKLRDKLKQVAEIKAPEVAVEQRSADGTIKWAMQVGDQQVETVYIP
EADRATLCVSSQVGCALACTFCSTAQQGFNRNLTVSEIIGQVWRASKIIGNFGVTGVRPI
TNVVMMGMGEPLLNVANVVPAMEIMLDDFAYGLSKRRVTLSTSGVVPALDKLSEMIDVAL
AISLHAPNDELRDEIVPINKKYNIKMLMDSVNRYLSVSNANHGKVTIEYVMLDHVNDGVE
HAHQLAQVLKNTPCKINLIPWNPFPEAPYAKSSNSRIDRFQKTLMEYGFTVIVRKTRGDD
IDAACGQLAGDVIDRTKRTAQKKQFGQEIAVRNH
Download sequence
Identical sequences A0A1D7R0G3 Q9CJJ8 V4NAS2
WP_010907446.1.10027 WP_010907446.1.10721 WP_010907446.1.12311 WP_010907446.1.1307 WP_010907446.1.15732 WP_010907446.1.17217 WP_010907446.1.18123 WP_010907446.1.19996 WP_010907446.1.20287 WP_010907446.1.22153 WP_010907446.1.2313 WP_010907446.1.23830 WP_010907446.1.24757 WP_010907446.1.26616 WP_010907446.1.27416 WP_010907446.1.29697 WP_010907446.1.30617 WP_010907446.1.34253 WP_010907446.1.35978 WP_010907446.1.39152 WP_010907446.1.40210 WP_010907446.1.40787 WP_010907446.1.41462 WP_010907446.1.42943 WP_010907446.1.44741 WP_010907446.1.45422 WP_010907446.1.47685 WP_010907446.1.4808 WP_010907446.1.52066 WP_010907446.1.53852 WP_010907446.1.57420 WP_010907446.1.58450 WP_010907446.1.58910 WP_010907446.1.59455 WP_010907446.1.60664 WP_010907446.1.61860 WP_010907446.1.62016 WP_010907446.1.6219 WP_010907446.1.62389 WP_010907446.1.65482 WP_010907446.1.65878 WP_010907446.1.66934 WP_010907446.1.66990 WP_010907446.1.73917 WP_010907446.1.74955 WP_010907446.1.75804 WP_010907446.1.80223 WP_010907446.1.80589 WP_010907446.1.80911 WP_010907446.1.81885 WP_010907446.1.8281 WP_010907446.1.86541 WP_010907446.1.87897 WP_010907446.1.89773 WP_010907446.1.90081 WP_010907446.1.90179 WP_010907446.1.91495 WP_010907446.1.94435 WP_010907446.1.9746 WP_010907446.1.9947 gi|15603872|ref|NP_246946.1| 272843.PM2007 gi|378774950|ref|YP_005177193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]