SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603875|ref|NP_246949.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603875|ref|NP_246949.1|
Domain Number 1 Region: 265-365
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000000746
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 15-208
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.000000000018
Family Dihydropteroate synthetase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15603875|ref|NP_246949.1|
Sequence length 367
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLAKPTIKRRESTKIYVGNVPIGGDAPIAVQSMTNTRTTDVEATVAQIKALERVGADIVR
VSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGREDRIRA
VVDCARDNNIPIRIGVNAGSLEKDLQEKYGEPTPEALLESALRHVEILDRLNFDQFKVSV
KASDVFLAVESYRLLAKAIKQPLHLGITEAGGFRAGAVKSAVGLGMLLAEGIGDTLRISL
AADPVEEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDV
SIIGCVVNGPGEALVSDLGVTGGNKKSGYYLDGERQKERFDNDDLINQLEAKIRAKVAAQ
DPKNRII
Download sequence
Identical sequences A0A1E3XJ39 A0A2K2YXB6 P57987
272843.PM2010 gi|15603875|ref|NP_246949.1| gi|386834958|ref|YP_006240275.1| WP_005719572.1.11014 WP_005719572.1.11214 WP_005719572.1.11947 WP_005719572.1.12156 WP_005719572.1.12311 WP_005719572.1.14908 WP_005719572.1.15732 WP_005719572.1.17980 WP_005719572.1.19996 WP_005719572.1.21657 WP_005719572.1.24757 WP_005719572.1.26777 WP_005719572.1.27664 WP_005719572.1.28084 WP_005719572.1.35562 WP_005719572.1.36022 WP_005719572.1.3807 WP_005719572.1.38246 WP_005719572.1.3839 WP_005719572.1.3957 WP_005719572.1.40210 WP_005719572.1.40787 WP_005719572.1.41297 WP_005719572.1.41351 WP_005719572.1.41657 WP_005719572.1.41667 WP_005719572.1.4211 WP_005719572.1.42469 WP_005719572.1.42512 WP_005719572.1.43687 WP_005719572.1.45422 WP_005719572.1.4808 WP_005719572.1.49053 WP_005719572.1.51342 WP_005719572.1.52585 WP_005719572.1.53852 WP_005719572.1.55074 WP_005719572.1.55401 WP_005719572.1.57956 WP_005719572.1.58111 WP_005719572.1.58257 WP_005719572.1.60478 WP_005719572.1.61098 WP_005719572.1.6219 WP_005719572.1.62389 WP_005719572.1.6332 WP_005719572.1.63549 WP_005719572.1.66990 WP_005719572.1.70689 WP_005719572.1.72215 WP_005719572.1.78987 WP_005719572.1.79347 WP_005719572.1.79593 WP_005719572.1.81885 WP_005719572.1.8281 WP_005719572.1.83579 WP_005719572.1.88402 WP_005719572.1.89773 WP_005719572.1.90578 WP_005719572.1.92478 WP_005719572.1.93940 WP_005719572.1.94432 WP_005719572.1.95718 WP_005719572.1.9746 WP_005719572.1.9947 gi|383310911|ref|YP_005363721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]