SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603876|ref|NP_246950.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603876|ref|NP_246950.1|
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.06e-100
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000044
Further Details:      
 
Domain Number 2 Region: 326-421
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.08e-24
Family Anticodon-binding domain of Class II aaRS 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603876|ref|NP_246950.1|
Sequence length 423
Comment histidyl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAKTIQAIRGMNDCSPTESPLWQWVEGKVRSVLQNYGYSEVRMPIVESTPLFARAIGEVT
DVVSKEMYTFWDNDEQLTLRPEGTAGCVRAAIEHGWIYNQEQRLWYMGPMFRHERPQKGR
YRQFHQAGVEVFGIPNPEIDAELIMLTARLWKELGIAEHVTLQLNSIGSLEARKNYRSAL
VAFLQQHVDLLSEEEKERLEKNPLRILDTKNQALQEVLNDAPKLLAYLDDDSREHFAQLC
ALLDAVGIQYEVNPKLVRGLDYYNKTVFEWVTSALGAQGTVCGGGRYDGLVEQLGGHATT
GVGFAMGLERLVLLVQEVNQSIRLPSAVDIYVVYQGEGTTLAAFQLAETLRTELPQLRVM
THCSGGNFKKQFKRADKSGATLALVIGESEVQNQQVVVKHLLGGAEQQTLALDDIVDYIK
NNF
Download sequence
Identical sequences P57988
gi|15603876|ref|NP_246950.1| 272843.PM2011 gi|386834957|ref|YP_006240274.1| WP_010907448.1.19996 WP_010907448.1.27592 WP_010907448.1.40210 WP_010907448.1.41657 WP_010907448.1.42512 WP_010907448.1.45422 WP_010907448.1.4808 WP_010907448.1.53852 WP_010907448.1.6219 WP_010907448.1.66990 WP_010907448.1.79593 WP_010907448.1.81885 WP_010907448.1.8281 WP_010907448.1.89773 WP_010907448.1.94432 WP_010907448.1.9746 WP_010907448.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]