SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15603880|ref|NP_246232.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15603880|ref|NP_246232.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ribosomal protein S16 9.03e-29
Family Ribosomal protein S16 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15603880|ref|NP_246232.1|
Sequence length 82
Comment 30S ribosomal protein S16 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPLATGNAERLRLDLDRVNAW
VEKGASLSDRVSALVKEAQKAA
Download sequence
Identical sequences A0A1E3XLK4 A0A2K2YL06 P58123 V4N911
WP_005717779.1.10027 WP_005717779.1.10721 WP_005717779.1.11214 WP_005717779.1.11947 WP_005717779.1.12156 WP_005717779.1.12311 WP_005717779.1.1307 WP_005717779.1.14908 WP_005717779.1.15732 WP_005717779.1.17217 WP_005717779.1.17980 WP_005717779.1.18123 WP_005717779.1.19996 WP_005717779.1.20287 WP_005717779.1.21657 WP_005717779.1.22153 WP_005717779.1.2313 WP_005717779.1.23830 WP_005717779.1.24757 WP_005717779.1.26616 WP_005717779.1.26777 WP_005717779.1.27416 WP_005717779.1.27592 WP_005717779.1.27664 WP_005717779.1.28084 WP_005717779.1.29697 WP_005717779.1.30617 WP_005717779.1.34253 WP_005717779.1.35562 WP_005717779.1.35978 WP_005717779.1.36022 WP_005717779.1.3807 WP_005717779.1.38246 WP_005717779.1.3839 WP_005717779.1.39152 WP_005717779.1.3957 WP_005717779.1.40210 WP_005717779.1.40787 WP_005717779.1.41297 WP_005717779.1.41351 WP_005717779.1.41462 WP_005717779.1.41657 WP_005717779.1.41667 WP_005717779.1.42512 WP_005717779.1.42943 WP_005717779.1.43687 WP_005717779.1.44741 WP_005717779.1.45422 WP_005717779.1.47685 WP_005717779.1.4808 WP_005717779.1.49053 WP_005717779.1.50853 WP_005717779.1.51342 WP_005717779.1.52066 WP_005717779.1.52585 WP_005717779.1.52859 WP_005717779.1.53852 WP_005717779.1.55074 WP_005717779.1.55401 WP_005717779.1.57420 WP_005717779.1.57956 WP_005717779.1.58111 WP_005717779.1.58257 WP_005717779.1.58450 WP_005717779.1.58628 WP_005717779.1.58910 WP_005717779.1.59455 WP_005717779.1.60478 WP_005717779.1.60664 WP_005717779.1.61098 WP_005717779.1.61860 WP_005717779.1.62016 WP_005717779.1.6219 WP_005717779.1.62389 WP_005717779.1.6332 WP_005717779.1.63549 WP_005717779.1.65482 WP_005717779.1.65878 WP_005717779.1.66934 WP_005717779.1.66990 WP_005717779.1.70689 WP_005717779.1.72215 WP_005717779.1.73917 WP_005717779.1.74955 WP_005717779.1.75804 WP_005717779.1.78987 WP_005717779.1.79347 WP_005717779.1.79593 WP_005717779.1.80223 WP_005717779.1.80589 WP_005717779.1.80911 WP_005717779.1.81885 WP_005717779.1.8281 WP_005717779.1.83579 WP_005717779.1.86541 WP_005717779.1.87897 WP_005717779.1.88402 WP_005717779.1.89773 WP_005717779.1.90081 WP_005717779.1.90179 WP_005717779.1.91495 WP_005717779.1.92478 WP_005717779.1.93940 WP_005717779.1.94432 WP_005717779.1.94435 WP_005717779.1.95718 WP_005717779.1.9746 WP_005717779.1.9947 gi|15603880|ref|NP_246232.1| gi|378775539|ref|YP_005177782.1| gi|383311546|ref|YP_005364356.1| 272843.PM1294a gi|386835703|ref|YP_006241023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]