SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161723302|ref|NP_246923.2| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161723302|ref|NP_246923.2|
Domain Number 1 Region: 6-229
Classification Level Classification E-value
Superfamily Ribosomal protein S2 3.92e-94
Family Ribosomal protein S2 0.00000000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161723302|ref|NP_246923.2|
Sequence length 240
Comment 30S ribosomal protein S2 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAQVSMRDMLQAGVHFGHQTRYWNPKMKPFIYGPRNGVHIINLEKTVPMFNEALVELTRI
AGNNGKILFVGTKRAATEAVKAAALDCQQYYVNHRWLGGMLTNWKTVRQSIRRLKDLETQ
SQDGTFDKLTKKEALMRTREMEKLELSLGGIKEMGGLPDALFVIGADHEHIAVKEANNLG
IPVFAIVDTNSDPDGVDFVIPGNDDAARAIQLYLSAAAAAVKEGRHQDAVTEENFVAEAE
Download sequence
Identical sequences A0A1E3XLZ2 A0A2K2YXI6 P57982
gi|161723302|ref|NP_246923.2| 272843.PM1984 gi|378774973|ref|YP_005177216.1| WP_005725076.1.10027 WP_005725076.1.10721 WP_005725076.1.11014 WP_005725076.1.11214 WP_005725076.1.11947 WP_005725076.1.12156 WP_005725076.1.12311 WP_005725076.1.1307 WP_005725076.1.14908 WP_005725076.1.15732 WP_005725076.1.17217 WP_005725076.1.17980 WP_005725076.1.18123 WP_005725076.1.19996 WP_005725076.1.20287 WP_005725076.1.21657 WP_005725076.1.22153 WP_005725076.1.2313 WP_005725076.1.23830 WP_005725076.1.24757 WP_005725076.1.26616 WP_005725076.1.26777 WP_005725076.1.27416 WP_005725076.1.27664 WP_005725076.1.28084 WP_005725076.1.29697 WP_005725076.1.30617 WP_005725076.1.34253 WP_005725076.1.35562 WP_005725076.1.35978 WP_005725076.1.36022 WP_005725076.1.3807 WP_005725076.1.38246 WP_005725076.1.3839 WP_005725076.1.39152 WP_005725076.1.3957 WP_005725076.1.40210 WP_005725076.1.40787 WP_005725076.1.41351 WP_005725076.1.41462 WP_005725076.1.41667 WP_005725076.1.42469 WP_005725076.1.42943 WP_005725076.1.43687 WP_005725076.1.44741 WP_005725076.1.45422 WP_005725076.1.47685 WP_005725076.1.4808 WP_005725076.1.49053 WP_005725076.1.50853 WP_005725076.1.51342 WP_005725076.1.52066 WP_005725076.1.52585 WP_005725076.1.53852 WP_005725076.1.55074 WP_005725076.1.55401 WP_005725076.1.57420 WP_005725076.1.58111 WP_005725076.1.58257 WP_005725076.1.58450 WP_005725076.1.58628 WP_005725076.1.58910 WP_005725076.1.59455 WP_005725076.1.60478 WP_005725076.1.60664 WP_005725076.1.61098 WP_005725076.1.61860 WP_005725076.1.62016 WP_005725076.1.6219 WP_005725076.1.62389 WP_005725076.1.6332 WP_005725076.1.63549 WP_005725076.1.65482 WP_005725076.1.65878 WP_005725076.1.66934 WP_005725076.1.66990 WP_005725076.1.70689 WP_005725076.1.72215 WP_005725076.1.73917 WP_005725076.1.74955 WP_005725076.1.75804 WP_005725076.1.78987 WP_005725076.1.79347 WP_005725076.1.79593 WP_005725076.1.80223 WP_005725076.1.80589 WP_005725076.1.80911 WP_005725076.1.81885 WP_005725076.1.8281 WP_005725076.1.83579 WP_005725076.1.86541 WP_005725076.1.87897 WP_005725076.1.88402 WP_005725076.1.89773 WP_005725076.1.90081 WP_005725076.1.90179 WP_005725076.1.90578 WP_005725076.1.91495 WP_005725076.1.92478 WP_005725076.1.93940 WP_005725076.1.94435 WP_005725076.1.95718 WP_005725076.1.9746 WP_005725076.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]