SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602467|ref|NP_245539.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602467|ref|NP_245539.1|
Domain Number 1 Region: 65-154
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 2.75e-33
Family Translation initiation factor IF3, C-terminal domain 0.00000828
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 4.45e-24
Family Translation initiation factor IF3, N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602467|ref|NP_245539.1|
Sequence length 154
Comment translation initiation factor IF-3 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIDQDGEQAGIVSIQQALEMAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKGKAAKEQK
KKQKVVQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITVRFRGREMAHQDIGLEVL
ERVKNDLAEISVVESAPGRLEGRQAVMVLAPKKK
Download sequence
Identical sequences A0A1E3XIM6 A0A2K2YZA3 V4N8N6
gi|386834277|ref|YP_006239592.1| gi|378774309|ref|YP_005176552.1| gi|15602467|ref|NP_245539.1| 272843.PM0602 gi|383310244|ref|YP_005363054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]