SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602927|ref|NP_245999.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602927|ref|NP_245999.1|
Domain Number 1 Region: 206-385
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 7.14e-47
Family Mannitol 2-dehydrogenase 0.0014
Further Details:      
 
Domain Number 2 Region: 1-204
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.24e-41
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602927|ref|NP_245999.1|
Sequence length 385
Comment mannitol-1-phosphate 5-dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKALHFGAGNIGRGFIGKLLADSGIQVIFADVNDHVIEQLKTQRAYPVKIVGDRLNVIET
VSNVTGVNSKNEADIIACFTEVDLVTTAVGPNVLKIISSTIAKGLSARFRAGNTRPLNII
ACENMVRGTSFLKDNVFSYLTPEEQQQAEAQIGFVDSAVDRIVPPVQFDPANPLLVTVEE
FSEWIVDKTQFKGTIPAITGMEQTDNLMAFVERKLFTLNTGHATTAYLGKLKGHQFVKDS
IDDPDIREAVKATMQESGAVLIKRYGFDPHAHAAYIEKILKRFANPYLQDDVDRVGREPL
RKLSYNDRLIKPLRGTLEYGLPNQHLIQTIASALAYRNESDPQAVELAQLLQQDTLESAV
KKITELTESNIVQQIVTAYNALQKN
Download sequence
Identical sequences Q9CLY7
272843.PM1062 WP_010906996.1.12311 WP_010906996.1.15732 WP_010906996.1.19996 WP_010906996.1.62389 WP_010906996.1.66990 WP_010906996.1.81885 WP_010906996.1.9947 gi|15602927|ref|NP_245999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]